SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G03900.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G03900.1
Domain Number 1 Region: 9-138
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-47
Family Necap1 N-terminal domain-like 0.0000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G03900.1
Sequence length 272
Sequence
MSFEEEEEEETFEHTLLVVREVSVYKIPPRTTSGGYKCGEWLQSDKIWSGRLRVVSCKDR
CEIRLEDSNSGDLFAACFVDPGRRENSVEPSLDSSRYFVLRIDDGRGKYAFIGLGFAERN
EAFDFNVALSDHEKYVRREKEKETGETSESDNHIDIHPAVNHRLKEGETIRINVKPKPTT
NGTGMLSAALSGTGKPKPLALAPPPKAAGVTRSPLPPPPNDPVASRIASDGCKESRRNEP
LSDLSQLKKNLPSTAGSGSSKSTGAASGWAAF
Download sequence
Identical sequences A0A178WMR3 Q681Q7
NP_563693.1.80155 AT1G03900.1 AT1G03900.1 3702.AT1G03900.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]