SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G05380.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G05380.1
Domain Number 1 Region: 617-672
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000687
Family PHD domain 0.0017
Further Details:      
 
Domain Number 2 Region: 811-902
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000157
Family N-acetyl transferase, NAT 0.027
Further Details:      
 
Weak hits

Sequence:  AT1G05380.1
Domain Number - Region: 669-708
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0266
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G05380.1
Sequence length 1138
Sequence
MEGGGGSGERSRIASNTPRSLKEKSDGVGRTVSSTETRQNYQKRSRMVVSDSESSDEFMK
PPPRRSGVDRKTLGAKEKFVRKRDRVEHDRNGYVRRNNEASGSFMKMNKLDIFEFDEYDG
FDSANLMRKRFDNGSVGVRGRSSFASRRVDSSVGRSGSGREGLFDRRRNTFVNGTCSASS
QEDSSSESDSDEPMRVQGINGVLKVKVNNKTNTLAASINPRDAEIYERPPSSRKAQRREN
VVVKPPFRKSNNVDNNSESEESDMSRKSKRKKSEYSKPKKEFNTKSKSTFPELVNPDVRE
ERRGRRGGGTDKQRLRERIKGMLTDAGWTIDYKPRRNQSYLDAVYVNPSGTAYWSIIKAY
DALLKQLKDEGVDARPRKDTAAVASVSEEIVNKLARKAKKTRSEMTKKWKQNSSGSDSEN
KSEGGAYTDTSEERIRSSIKLGGKSTKKGRNGADWDELHKKSKRSLYYNNARPSCGSDSH
YLHGRKTKKIGRCTLLVRSSKDKKNPAINGFNPYSGKRTLLSWLIESGVVQLRQKVQYMR
RRGAKVMLEGWITREGIHCDCCSKILTVSRFEIHAGSKSCQPFQNIYLESGASLLQCQVR
AWNMQKDATNLALHQVDTDGDDPNDDACGICGDGGDLICCDGCPSTYHQNCLGMQVLPSG
DWHCPNCTCKFCDAAVASGGKDGNFISLLSCGMCERRYHQLCLNDEAHKVQSFGSASSFC
GPKCLELFEKLQKYLGVKTEIEGGYSWSLIHRVDTDSDTNSQMSAQRIENNSKLAVGLAI
MDECFLPIVDRRSGVDLIRNVLYNCGSNFNRINYTGFYTAILERGDEIISAASLRFHGMQ
LAEMPFIGTRHIYRRQGMCRRLFDAIESAMRSLKVEKLVIPAIPDFLHAWTGNFGFTPLD
DSVRKEMRSLNTLVFPGIDMLQKPLLHEENIIAPAAAGDAMISEVETEKKSEFTSSVEIG
PYAVEGDEFVADAANCYKDILASDEDNILVSVETAMGTICKPKDELSRHFRGEESGISSS
PCQITLKSGTKHVLGHICDDTGSSCEDGLTDVNVEADASLLSQEIQQASASFKVENNLSL
SISGRGSSDLSSISQEVKSEQTSSNLDGVPSCKDYNILVPGAKLDKSKDDAFADGFLL
Download sequence
Identical sequences Q9ZW00
AT1G05380.1 AT1G05380.2 NP_001117233.1.80155 NP_001322107.1.80155 NP_563736.3.80155 AT1G05380.1 3702.AT1G05380.2-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]