SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G05615.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT1G05615.1
Domain Number - Region: 95-155
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00018
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G05615.1
Sequence length 172
Sequence
MGAIHDEPFTACGDETECFGGNREGSQSFHSSSTKEENLEDSYLYLVHQRSMSIFFWDER
ANTGVAGAVDEGKIIDFEFLNPDEKRIIEEHANKEREEGVDVILVNFDRREYMLNLRRWN
MGTSPLYILVSGRYNVVKGCRLKEGNEIRIWSFHFDDQLNLAMVPLTPTESG
Download sequence
Identical sequences F4I8U3
AT1G05615.1 3702.AT1G05615.1-P NP_683278.1.80155 AT1G05615.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]