SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G05630.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G05630.2
Domain Number 1 Region: 548-742,775-940
Classification Level Classification E-value
Superfamily DNase I-like 3.21e-57
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.000027
Further Details:      
 
Domain Number 2 Region: 163-378,439-554
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 1.96e-25
Family Putative isomerase YbhE 0.027
Further Details:      
 
Weak hits

Sequence:  AT1G05630.2
Domain Number - Region: 1012-1045
Classification Level Classification E-value
Superfamily PapD-like 0.0759
Family MSP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G05630.2
Sequence length 1136
Sequence
MDSLIIEEEDEEALATLVPVPPRRKTHSYSLQFDHKPHHQIRKHSLDEVPRSATLASEAV
YFDSSDDEFSTGGNITENAADETNAGAEEYTIVNPPPNVGLGDDDTEPLPEFIGAGGGSG
IFKVPVRAAVHPGRPPCLELRPHPLRETQTGRFLRNIACTETQLWAGQENGIRFWNLEDA
YEAGCGIGGQVPRGDEDTAPFHESVTTSPTMCLVADQSNKLLWSGHKDGKIRAWKMDQSS
VSHDDDDSDPFKERVSWLAHRGPVNSIVISSYGDMWSCSEGGVIKIWPWDTLEKSLLLKP
EEKHMAALLVERSAIDLRSQVTVNGTCSISSSEVKFLLADSVRAKVWAVQSLSFSIWDAR
SKDLLKVLNVDGQVENRGDLPPIQDQQVDDEMKLKFFSASKREKPQGFLQRSRNAIMGAA
GAVRRVATRSAGAFSEDTRKTEAIVLAVDGTIWTGSISGLIVQWDGNGNRLRDVNHHHRP
VLCFCTFGDRIYVGYASGYIQVLDLDGKLISSWVSHNEPVIKLAAGGGFIFSLATHGGVR
GWYVTSPGPLDNIIRTELSQKETLYARQDNVRILIGTWNVGQGRASHDALMSWLGSVTSD
VGIVAVGLQEVEMGAGFLAMSAAKETVGLEGSAVGQWWIDAIGKALDEKNTFERMGSRQL
AGLLISLWARKDIRTHVGDLDVAAVPCGFGRAIGNKGGVGLRIRVYDRIMCFVNCHLAAH
LEAVNRRNADFNHIFRLMVFSRGQNLSNAAAAGVSTSAYTTKSNTIPSTGAEEIKSDLAA
ADMVAFFGDFNYRLFGITYDEARDFISQRSFDWLRERDQLRAEMKVGKVFQGMREALITF
PPTYKFERNRSGLGGYDSGEKKRIPAWCDRVIYRDTQSSPFSESNLQCPVVSSVIMYEAC
MDVTESDHKPVRCKFHATIAHVDKSVRRQELGKIIRSNEKILSIFEDLRFVPETSVSTNN
IVLQSQDTVILTITNNSPTSQAIFNILCGGQAVVKDDGEDADYNPRGSFGLPRWLEVSPA
AGIINPEGSVDVKVHHEDFYSMEEYVDGIPQNWWCEDTRDKEAILMVNIRGSCSTTLRSH
SVKVRHCFSARVCLLENRPTNLTKNLGGSRRYPTDITRNGSTRPRTEDSVRRGKSR
Download sequence
Identical sequences Q9SYK4
AT1G05630.2 NP_001030976.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]