SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G06190.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT1G06190.1
Domain Number - Region: 362-394
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00161
Family Rho termination factor, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G06190.1
Sequence length 401
Sequence
MAMSGTFHLTSDYVPGYTLSDSRCFFNSAVSRRTLAILPCSSCLDHKNGRLKSVPNRSSF
VCRASSGGYRRNPDFSRLNKHGYRGNNRQSGGREDFDIENSDMLSSRNGPLFNLSSSPKF
QATSSPGPREKEIVELFRKVQAQLRARAAAKKEEKKIEEASKGQGKESETVDSLLKLLRK
HSGEQSKRQVSKFSSQGEVQGDTVDKQDRTGNLVTSGNKDNNASSFTRPTSSFRRKSPVP
RSQSPPAYSSEATFDQSSSYSVTWTQKKDTVELHDEPEHEPAYEHEHEPENESEPGPVTT
MLEPDSELKPESSSFYQEEEDDDVTFDVLSQDDGILDVLSDDDESLDDADEDSDEAEEEA
VKDLSELKLVELRGIAKSRGLKGLSKMKKAELVELLGSDSS
Download sequence
Identical sequences Q94K75
3702.AT1G06190.1-P AT1G06190.1 NP_563761.1.80155 AT1G06190.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]