SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G08370.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G08370.1
Domain Number 1 Region: 19-139
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-49
Family Dcp1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G08370.1
Sequence length 367
Sequence
MSQNGKIIPNLDQNSTRLLNLTVLQRIDPYIEEILITAAHVTFYEFNIELSQWSRKDVEG
SLFVVKRSTQPRFQFIVMNRRNTDNLVENLLGDFEYEVQGPYLLYRNASQEVNGIWFYNK
RECEEVATLFNRILSAYSKVNQKPKASSSKSEFEELEAKPTMAVMDGPLEPSSTARDAPD
DPAFVNFFSSTMNLGNTASGSASGPYQSSAIPHQPHQPHQPTIAPPVAAAAPPQIQSPPP
LQSSSPLMTLFDNNPEVISSNSNIHTDLVTPSFFGPPRMMAQPHLIPGVSMPTAPPLNPN
NASHQQRSYGTPVLQPFPPPTPPPSLAPAPTGPVISRDKVKEALLSLLQEDEFIDKITRT
LQNALQQ
Download sequence
Identical sequences Q9SJF3
NP_563814.1.80155 AT1G08370.1 AT1G08370.1 3702.AT1G08370.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]