SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G08600.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G08600.2
Domain Number 1 Region: 979-1054,1107-1301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-55
Family Tandem AAA-ATPase domain 0.0000615
Further Details:      
 
Domain Number 2 Region: 705-973
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-46
Family Tandem AAA-ATPase domain 0.00014
Further Details:      
 
Weak hits

Sequence:  AT1G08600.2
Domain Number - Region: 471-533
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000731
Family Transcriptional factor domain 0.072
Further Details:      
 
Domain Number - Region: 521-578
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00403
Family PHD domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G08600.2
Sequence length 1479
Sequence
MEANEESLKGKIEKLEGKEVIVESKEDEMDIIIEENREAEQEVMEVKARDGRGEQNDVLM
EENNNQGEQKDEEMQDASSRSESSDFNSDEDEQILSRRDDELDLEKPLSEEEIDELISDL
LAVESKAAEAQEALEKESLSKVESEVREELAQALRGDELDEAVAAEMMTFKDEWEATLDE
LETESATLLEQLDGAGIELPKLYEMIESQAPNGCYTEAWKQRAHWVGTQVTKETVESLAN
AERFLHTHRPVRKRHGKLLEEGASGFLEKKLADGAVKESLAGTSELDWSSLNKVFSEKRD
ESVSFGSKQWASVYLASTPHQAAAMGLEFPGVNEVEEIEEIDASLADPFLADAIDNEREL
ALTEEQKTNYIRVKEEDDITCDRVLQLRLKRKRRKKRSKQVIRCAAENMDDDSVYLDGNN
TTPNFAKDQVKSPETSTQVHNSEVNIEENGNFSNSDVDKMTPSTHINVDAKRDDSQNPAN
NFRCTACNKVAVEVHSHPLLEVIVCMDCKRSIEDRVSKVDDSLERHCEWCGHIADLIDCR
TCEKLFCASCIKRNIGEEYMSEAQSSGWDCCCCSPIPLQRLTLELEKAMRDKKSIELSSD
SSSDSSSDNNSVDTDADVNVTISSKKKSKKKIRRIIDDAELGKDTRTKIAIEKARQERLR
SLQFSARYKTISSMGDVKSIPEGAEVEVLGDAHSGYIVNVVREIGEEAVRVPRSISAKLK
VHQVTGIRFMWENIIQSISRVKSGDKGLGCILAHTMGLGKTFQVIAFLYTAMRCVDLGLK
TALIVTPVNVLHNWRSEFEKWMPSEVKPLRIFMLGDVSRERRFDLLTKWRKKGGVFLMGY
TNFRNLSLGRGVKDLNAARGICNALRDGPDILVCDEAHIIKNTKADTTQALKQVKCQRRI
ALTGSPLQNNLMEYYCMVDFVREGFLGSSPEFRNRFQNPIENGQHMNSTAEDVKIMNQRS
HILYEQLKGFVQRMDMNVVKKDLPPKTVFVISVKLSPLQRILYQRFLELYGFSDGRTDER
MRKNFFAAYQVLAQILNHPGIPQLRSEDSKNGRRGSIVDIPDDCSSDENIDYNMVTGEKQ
RTMNDLQDKVDGYLQKDWWVDLLQKNNYKVSDFSGKMILLLDILSMSADVGDKALVFSQS
IPTLDLIELYLSRVPRHGKQGKFWKKGKDWYRIDGKTESSERQKLVDRFNEPDNKRVKCT
LISTRAGSLGINLYAANRVIIVDGSWNPTYDLQAIFRAWRYGQKKPVFAYRLMARGTIEE
KIYKRQVTKEGLAARVVDRQQVHRTISKEEMLHLFEFDDDDEKSEAVTEISKQNEAGHSN
LVEQAILWTKKATLSRVGGDKLMENLLQRHGPNWISSFHEHETLLQENEEERLTKEEKDM
AWEVYRRALEWEEVQRVPFSESPVVPKPSPSTQTEPLPQPKGFNRSRFVNRNCTRIAHQL
TLISQGLKVGSSTVCGECGRVIRWEDVIPASKLSAVIVN
Download sequence
Identical sequences A0A178VZQ9 F4HW51
NP_001184937.1.80155 NP_001184938.1.80155 NP_001184939.1.80155 AT1G08600.2 AT1G08600.2 AT1G08600.3 AT1G08600.4 3702.AT1G08600.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]