SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G08820.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G08820.2
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily PapD-like 3.66e-40
Family MSP-like 0.0023
Further Details:      
 
Weak hits

Sequence:  AT1G08820.2
Domain Number - Region: 302-355
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G08820.2
Sequence length 386
Sequence
MNMPLLDIQPRTLQFAVDLKKQTSCVVQLTNTTHHYVAFKVKTTSPKKYCVRPNVGVVAP
KSTCEFTVIMQAFKEPPPDMVCKDKFLIQSTAVSAETTDEDITASMFSKAEGKHIEENKL
RVTLVPPSDSPELSPINTPKQGAVFEDSILKDRLYSQSETLAPPQYEGEIVKEPRMVGHD
ELKAADNAKELKTPKMATVDFVEDRYTANDLKATKDSYDSSRMAKETGFDPIRSHKDADD
GRAIKATTNLDAPMKKAMDLPRDQGFTNGIAVDSEPKISKERDVVQLQKTDGQNVRGLDE
LKLVKDIEEMKLKVDALESKLKQADSTISKLMEERSISSQHRQSLQHELAELRTKKIVKE
VHNGFPLLYVCVVAFIAYVIGHFLRT
Download sequence
Identical sequences A0A178WBB7 B9DHD7
NP_001031004.1.80155 NP_001321655.1.80155 NP_001321656.1.80155 NP_001321657.1.80155 NP_172359.2.80155 3702.AT1G08820.1-P AT1G08820.1 AT1G08820.2 AT1G08820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]