SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G09280.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G09280.1
Domain Number 1 Region: 132-272
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000000165
Family Single-domain sulfurtransferase 0.04
Further Details:      
 
Domain Number 2 Region: 351-392,423-580
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000279
Family Carboxylesterase/thioesterase 1 0.071
Further Details:      
 
Weak hits

Sequence:  AT1G09280.1
Domain Number - Region: 278-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00403
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G09280.1
Sequence length 581
Sequence
MGTSSCGDHEKQRIEDEEQYGVLLYYKYTSVPDLDELVSFYESSCNSLGLLGRVRLSPKG
VNVTVGGKLTALEEHIAAAKSNCLFEGTDFKLASCHHPLNDKVAEECGFTSLSIRVVEEL
VTFSPCPPLKPPEISNAGKHLSAAEFHSVLQSANGKSENKELVLLDARNLYETRIGKFES
ENVETLDPEIRQYSDLPTWIDQNAEKMKGKNVLMYCTGGIRCEMASAYIRSKGAGFENTF
QLYGGIQRYLEQFPSGGFFKGKNFVFDHRISVGSSKEDIIGSCLLCNNTFDDYSPRCRCR
LCRMLVLVCNHCRVKGDIYICELCRKHGKGEVPLSLDPLNQPSESNGDNTRRKLRILCLH
GFRQNASSFKGRTGSLAKKLKNIAELVFIDAPHELQFIYQTATPPSGVCNKKFAWLVSSD
FDKPSETGWTVAQCQFDPLQYQTQTEGFDKSLTYLKTAFEEKGPFDGILGFSQGAAMAAA
VCGKQEQLVGEIDFRFCVLCSGFTPWPLLEMKEKRSIKCPSLHIFGSQPGKDRQIVTQAS
SDLAGLFEDGCATIVEHDFGHIIPTKSPYIDEIKAFLYQFI
Download sequence
Identical sequences Q94AC1
AT1G09280.1 AT1G09280.1 3702.AT1G09280.1-P AR2685 NP_563840.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]