SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G10870.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G10870.1
Domain Number 1 Region: 7-242,286-311
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.84e-61
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 469-596
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.00041
Further Details:      
 
Domain Number 3 Region: 283-329,366-439
Classification Level Classification E-value
Superfamily PH domain-like 1.33e-22
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 4 Region: 630-761
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-20
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G10870.1
Sequence length 775
Sequence
MATFINLEDSPMFQKQVCSLEGTADELKDRCQKLYKGVKKFMGTLGEASKGESAFAACLE
EFGGGPDDPISLSIGGPVISKFINALRELASYKEFLCSQVEHVLLERLMNFISVDLQEAK
ESRHRFDKAAHSYDQSREKFVSLKKNTRGEIVAELEEDLENSKSTFEKSRFNLVNSLMTI
EAKKKYEFLESISAIMDAHLRYFKLGYDLLNQLEPFIHQILTYAQQSKEQSKIEQDRLAR
RIQEFRTQSELDSQQLVANAESSGANGNRVGGNIPYKNTETSLTADKEVIKQGYLLKRSS
SLRTDWKRKFFVLDSHGSMYYYRTNGNKSMGSHHHYSGSSDHNTGVFGRFRARHNRSGSL
TEGSLGYNTIDLRTSLIKLDAEDMDLRLCFRIISPQKTYTLQAENGADRMDWVNKITKAI
GTLLNSHFLQQSPVRYLDKDNSSSAPANAVVSGDQIRHNDSRQNIGDDVSTILRGLPGNN
ACAECNAPEPDWASLNLGVLLCIQCSGVHRNLGVHISKVRSLSLDVKVWEPTILDLFRNL
GNVYCNSLWEGLLHLDDDCEDGSALSHASVSKPCPEDSFSVKEKYILGKYLEKALVIKDE
SEANLSAASRIWEAVQSRNIREIYRLIVTTGDVNIINTKFDDITDIDAYHHIDAAEKAVK
KRHDPTVCQRIKESNEPRSCLQGCSLLHVACHIGDSVLLELLLQFGADLNIRDYHGRTPL
HHCISSGNHKFAKILLRRGARPSIEDDGGLSVLERAMEMGAITDEELFLLLAECA
Download sequence
Identical sequences A0A178WDZ0 Q9SMX5
NP_172556.2.80155 AT1G10870.1 AT1G10870.1 3702.AT1G10870.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]