SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G12610.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G12610.1
Domain Number 1 Region: 29-88
Classification Level Classification E-value
Superfamily DNA-binding domain 3.66e-19
Family GCC-box binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G12610.1
Sequence length 209
Sequence
MNNDDIILAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYP
TADMAARAHDVAVLALRGRSACLNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPVDLE
SGITVLPCAGDDVDLGFGSGSGSGSGSEERNSSSYGFGDYEEVSTTMMRLAEGPLMSPPR
SYMEDMTPTNVYTEEEMCYEDMSLWSYRY
Download sequence
Identical sequences A0A178WLZ7 Q9LN86
NP_172721.1.80155 AT1G12610.1 3702.AT1G12610.1-P AT1G12610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]