SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G13170.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G13170.1
Domain Number 1 Region: 428-799
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 9.55e-115
Family Oxysterol-binding protein 0.00048
Further Details:      
 
Domain Number 2 Region: 95-125,171-229
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000136
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G13170.1
Sequence length 816
Sequence
MNPLCCIAPVSIDDRTNPVVAKSSNHHLGLEAIPVSKHASKPSFSTQASWISQDQLERLS
SEVVDDVNLDGKDASSSSNKGCFFFGNCVGAGAGVAGIMYKWVNYGKGWRARWFELEDGV
LSYYKIHGPDKIVMNPSREKGVRVIGEESVRYIRKASCGSSNRLGASAVAASRPCKPFGE
IHLKVSSIRASKSDDKRLAIFTGTKTLHLRCVSKENRAAWVEAFQVAKDLFPRVASGDIL
PSEDAVVSTEKLREKLLQEGVGETVVKDCEAIMLSEVSVLQNRLKVLTHKHIILLDTLRQ
LETEKIELEATVVDETKEHDSCCGQGRRFSDFYSVMSEVSASDSEADNESQDGADVESDE
DDVPYFDTNDILSAEAMRSASYRSREAEGNGSIYDKDPFFSDRLQIPARIPQYPYVRRRD
NLPEPKEKEKPVGLWSIIKENIGKDLSGVCLPVYFNEPLSSLQKCFEDLEYSYLIDRALE
WGKQGNELMRILNIAAFAVSGYASTEGRQCKPFNPLLGETYEADYPDKGLRFFSEKVSHH
PMIVACHCEGQGWNFWGDSNIKGKFWGRSIQLDPVGVLTLKFDDGEIYQWSKVTTSIYNI
ILGKLYCDHYGTMRIKGGSNYSCRLKFKEQSVIDRNPRQVHGFVQDNRTGEKVAILIGKW
DEAMYYVLGDPTTKPKGYDPMTEAVLLWERDKSPTKTRYNLSPFAISLNEITPGMIDKLP
PTDSRLRPDQRHLENGEYESANAEKLRLEQLQRQARRLQEKGWKPRWFEKDEEGNYRYLG
GYWEAREKKDWDRITDIFKKQQQRNSLSSSSSSTFL
Download sequence
Identical sequences Q9SAF0
AT1G13170.1 NP_172776.1.80155 3702.AT1G13170.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]