SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G13170.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G13170.2
Domain Number 1 Region: 428-820
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.75e-111
Family Oxysterol-binding protein 0.00047
Further Details:      
 
Domain Number 2 Region: 95-125,171-229
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000141
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G13170.2
Sequence length 837
Sequence
MNPLCCIAPVSIDDRTNPVVAKSSNHHLGLEAIPVSKHASKPSFSTQASWISQDQLERLS
SEVVDDVNLDGKDASSSSNKGCFFFGNCVGAGAGVAGIMYKWVNYGKGWRARWFELEDGV
LSYYKIHGPDKIVMNPSREKGVRVIGEESVRYIRKASCGSSNRLGASAVAASRPCKPFGE
IHLKVSSIRASKSDDKRLAIFTGTKTLHLRCVSKENRAAWVEAFQVAKDLFPRVASGDIL
PSEDAVVSTEKLREKLLQEGVGETVVKDCEAIMLSEVSVLQNRLKVLTHKHIILLDTLRQ
LETEKIELEATVVDETKEHDSCCGQGRRFSDFYSVMSEVSASDSEADNESQDGADVESDE
DDVPYFDTNDILSAEAMRSASYRSREAEGNGSIYDKDPFFSDRLQIPARIPQYPYVRRRD
NLPEPKEKEKPVGLWSIIKENIGKDLSGVCLPVYFNEPLSSLQKCFEDLEYSYLIDRALE
WGKQVRSFSLFLILVRYRKEWFILQGNELMRILNIAAFAVSGYASTEGRQCKPFNPLLGE
TYEADYPDKGLRFFSEKVSHHPMIVACHCEGQGWNFWGDSNIKGKFWGRSIQLDPVGVLT
LKFDDGEIYQWSKVTTSIYNIILGKLYCDHYGTMRIKGGSNYSCRLKFKEQSVIDRNPRQ
VHGFVQDNRTGEKVAILIGKWDEAMYYVLGDPTTKPKGYDPMTEAVLLWERDKSPTKTRY
NLSPFAISLNEITPGMIDKLPPTDSRLRPDQRHLENGEYESANAEKLRLEQLQRQARRLQ
EKGWKPRWFEKDEEGNYRYLGGYWEAREKKDWDRITDIFKKQQQRNSLSSSSSSTFL
Download sequence
Identical sequences F4HP28
AT1G13170.2 AT1G13170.2 NP_001184980.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]