SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G14770.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G14770.2
Domain Number 1 Region: 344-395
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000266
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G14770.2
Sequence length 429
Sequence
MDDHGGSDLSLEDLMDEYSSRPAQIAEWLWCIEYVAKFVKDLSCLLDLMNIGYQYSDDYG
KRINEVLSLRVLEFMFDPSMSDANGVGVASALEEKVEFDLSLSNADVLRGILKEIPVAEL
RVGMPELSKFNVLPFIAHKNLCLPQCALEKLRDVSLMENQTSATPFMETNDPVFRDDRSV
HMDLCEEEPVDEQQLHIGNAKEPTDEQHVHIGNEKESIDEQQVHIGLELNRNEKDKVIAI
DDEDEPMHTNEKGEVVVINDDTESDQGTTSDGTFSPRHNGNTTDETTFSPSSRRSPEDAH
VKCTKDGTWLISGSDDESDKDPPSIKKNPNTYLNLLPSSSRTRPENVCWKCEKEGTLLIC
SRSECAAKVHKECLNCPVNVDEYGNFLCPLCWYDRLAMEYHESQKLISCAKRRLVKCFPV
LSIRSKRLK
Download sequence
Identical sequences A0A178WG30 Q9LQV4
AT1G14770.1 AT1G14770.2 AT1G14770.1 3702.AT1G14770.2-P NP_172930.1.80155 NP_973829.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]