SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G16060.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G16060.2
Domain Number 1 Region: 89-150
Classification Level Classification E-value
Superfamily DNA-binding domain 1.5e-17
Family GCC-box binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 19-55
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000034
Family GCC-box binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G16060.2
Sequence length 275
Sequence
MFFFLVLLTMLTGIMADSSRAVYLGAYDEEDAAARAYDLAALKYWGRDTILNFPLCNYEE
DIKEMESQSKEEYIGSLRRKSSGFSRGVSKYRGVAKHHHNGRWEARIGRVFGNKYLYLGT
YATQEEAAIAYDIAAIEYRGLNAVTNFDISRYLKLPVPENPIDTANNLLESPHSDLSPFI
KPNHESDLSQSQSSSEDNDDRKTKLLKSSPLVAEEVIGPSTPPEIAPPRRSFPEDIQTYF
GCQNSGKLTAEEDDVIFGDLDSFLTPDFYSELNDC
Download sequence
Identical sequences AT1G16060.2 NP_973839.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]