SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G16710.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G16710.1
Domain Number 1 Region: 630-721
Classification Level Classification E-value
Superfamily TAZ domain 2.88e-23
Family TAZ domain 0.00075
Further Details:      
 
Domain Number 2 Region: 1590-1672
Classification Level Classification E-value
Superfamily TAZ domain 1.31e-22
Family TAZ domain 0.00028
Further Details:      
 
Domain Number 3 Region: 1388-1444
Classification Level Classification E-value
Superfamily RING/U-box 3.41e-16
Family ZZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 1509-1576
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000235
Family ZZ domain 0.0061
Further Details:      
 
Domain Number 5 Region: 1033-1075
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000122
Family PHD domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G16710.1
Sequence length 1706
Sequence
MNVQAHMSGQRSGQVPNQGTVPQNNGNSQMQNLVGSNGAATAVTGAGAATGSGTGVRPSR
NIVGAMDHDIMKLRQYMQTLVFNMLQQRQPSPADAASKAKYMDVARRLEEGLFKMAVTKE
DYMNRSTLESRITSLIKGRQINNYNQRHANSSSVGTMIPTPGLSQTAGNPNLMVTSSVDA
TIVGNTNITSTALNTGNPLIAGGMHGGNMSNGYQHSSRNFSLGSGGSMTSMGAQRSTAQM
IPTPGFVNSVTNNNSGGFSAEPTIVPQSQQQQQRQHTGGQNSHMLSNHMAAGVRPDMQSK
PSGAANSSVNGDVGANEKIVDSGSSYTNASKKLQQGNFSLLSFCPDDLISGQHIESTFHI
SGEGYSTTNPDPFDGAITSAGTGTKAHNINTASFQPVSRVNSSLSHQQQFQQPPNRFQQQ
PNQIQQQQQQFLNQRKLKQQTPQQHRLISNDGLGKTQVDSDMVTKVKCEPGMENKSQAPQ
SQASERFQLSQLQNQYQNSGEDCQADAQLLPVESQSDICTSLPQNSQQIQQMMHPQNIGS
DSSNSFSNLAVGVKSESSPQGQWPSKSQENTLMSNAISSGKHIQEDFRQRITGMDEAQPN
NLTEGSVIGQNHTSTISESHNLQNSIGTTCRYGNVSHDPKFKNQQRWLLFLRHARSCKPP
GGRCQDQNCVTVQKLWSHMDNCADPQCLYPRCRHTKALIGHYKNCKDPRCPVCVPVKTYQ
QQANVRALARLKNESSAVGSVNRSVVSNDSLSANAGAVSGTPRCADTLDNLQPSLKRLKV
EQSFQPVVPKTESCKSSIVSTTEADLSQDAERKDHRPLKSETMEVKVEIPDNSVQAGFGI
KETKSEPFENVPKPKPVSEPGKHGLSGDSPKQENIKMKKEPGWPKKEPGCPKKEELVESP
ELTSKSRKPKIKGVSLTELFTPEQVREHIRGLRQWVGQSKAKAEKNQAMENSMSENSCQL
CAVEKLTFEPPPIYCTPCGARIKRNAMYYTVGGGETRHYFCIPCYNESRGDTILAEGTSM
PKAKLEKKKNDEEIEESWVQCDKCQAWQHQICALFNGRRNDGGQAEYTCPYCYVIDVEQN
ERKPLLQSAVLGAKDLPRTILSDHIEQRLFKRLKQERTERARVQGTSYDEIPTVESLVVR
VVSSVDKKLEVKSRFLEIFREDNFPTEFPYKSKVVLLFQKIEGVEVCLFGMYVQEFGSEC
SNPNQRRVYLSYLDSVKYFRPDIKSANGEALRTFVYHEILIGYLEYCKLRGFTSCYIWAC
PPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAAKEGIVAETTNLYDHFFLQTGECR
AKVTAARLPYFDGDYWPGAAEDIISQMSQEDDGRKGNKKGILKKPITKRALKASGQSDFS
GNASKDLLLMHKLGETIHPMKEDFIMVHLQHSCTHCCTLMVTGNRWVCSQCKDFQLCDGC
YEAEQKREDRERHPVNQKDKHNIFPVEIADIPTDTKDRDEILESEFFDTRQAFLSLCQGN
HYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCHLDIESGLGWRCEVCPDYDVCNAC
YKKEGCINHPHKLTTHPSLADQNAQNKEARQLRVLQLRKMLDLLVHASQCRSPVCLYPNC
RKVKGLFRHGLRCKVRASGGCVLCKKMWYLLQLHARACKESECDVPRCGDLKEHLRRLQQ
QSDSRRRAAVMEMMRQRAAEVAGTSG
Download sequence
Identical sequences Q9FWQ5
AT1G16710.1 3702.AT1G16710.1-P NP_173115.1.80155 AT1G16710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]