SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G20110.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G20110.1
Domain Number 1 Region: 450-520
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.68e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  AT1G20110.1
Domain Number - Region: 313-364
Classification Level Classification E-value
Superfamily PH domain-like 0.000726
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G20110.1
Sequence length 601
Sequence
MQQGDYNSYYHHQYSQFQNPTPNPNPNPNPSPPAPATVAGPTDLTRNTYASAPPFTGGYG
SADYSNYSQNYTPYGQNSEHVPPSAPSFTSPSQPPPSPPATSLNPNSYSTFNQPPPPPTI
HPQPLSSYGSFDSTAPYQQPTSQHMYYSPYDQHQTSGYSSAPPPSSAPAPNPNPAPYSSS
LYSAPPYSSGGSSIPPSYEKPSVKFDQSGYDGYNRSRSDLGSDLYGKRSDSGEYPAFEDS
YGDGVYAYQGGKVEPYGSRGTAPKSSNSTLFDDYGRSISFSSSGRDSSVSSNSAKIVRAV
PKADVQEDSTGGVQKFRVKLLAETYGQTTTDVLCQIGLDGLRMLDPSTSRTLRIYPLENI
TRCEKLDSSILAFWSKTPVDIEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPT
SGKLIEQTAEKKKGLGDWMNIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNC
GDVFCDKCTQGRIALTAEDNAPQVRVCDRCMAEVSQRLSNAKETTGRNVSLQSHEDLARK
LQEEMERNRKSSSGLREGSGRRMKEVACPTCTVHLQVQVPVSGSETIECGVCQNPFLVSA
H
Download sequence
Identical sequences Q9ASS2
NP_564103.1.80155 AT1G20110.1 3702.AT1G20110.1-P AT1G20110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]