SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G21650.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G21650.2
Domain Number 1 Region: 71-296,417-464
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-72
Family Tandem AAA-ATPase domain 0.000000265
Further Details:      
 
Domain Number 2 Region: 468-574,670-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-41
Family Tandem AAA-ATPase domain 0.0000406
Further Details:      
 
Domain Number 3 Region: 775-909,972-1045
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.58e-40
Family Helical scaffold and wing domains of SecA 0.00061
Further Details:      
 
Domain Number 4 Region: 295-416
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 9.29e-37
Family Pre-protein crosslinking domain of SecA 0.0000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G21650.2
Sequence length 1058
Sequence
MGSVSNLVSPNICHPAPPCLTSRSNKFPWTKPISGLLFYRSVTPIKRCHLVRRSCVVSAS
LTGNLGRLKRNVQDFTSMNYWVVRDYYRLVESVNSLEPQIQSLSDEQLKAKTAEFRERLA
RGESLADMQAEAFAVVREAAKRTIGMRHFDVQIIGGGVLHDGSIAEMKTGEGKTLVSTLA
AYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQRGMKAEERKFNYSCDIT
YTNNSELGFDYLRDNLTSNREQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEANEN
AARYPVAAKVAELLVKDSHYKVELKENSVELTEEGISLAEMALETGDLWDENDPWARFVM
NALKAKEFYKRDVQYIVRDGKALIINELTGRVEDKRRWSEGVHQAVEAKEGLEIQADSIV
VAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFQIPVIEVPTNLSNIRIDLPIQAFATA
RGKWEHVRREVEDMFGQGRPVLVGTTSVENSEYLSELLKEWGIPHNVLNARPKYAAREAD
FIAQAGRKYAITISTNMAGRGTDIILGGNPKMLAREIIEDSILSYLTSEVLADNIDDDEL
SQKVLSKIKVGPSSLALLARASLMAKYVGKSESKSWTRKKAKSVVTESLEKSQTMDPMEL
QNLINEQSEMYPLGPAIALAYLSVLKDCEAHCLHEGSEVKRLGGLHVIGTSLHESRRIDN
QLRGRAGRQGDPGSTRFMISLQDEMFQKFNFDTEWAVRLISKITNDEDLPIEGDTIVKQL
LALQINAEKYFFGIRKSLVEFDEVLEVQRKHVYDLRQLLLTGENESCSQHIFQYMQAVVD
EIVVGNSNPQKHPRYWSLAKLLKEFMAISGNLLDESFSGITEETMLQSLENLHEGSSIEM
EDLSLPHLPKPPNAFRGIRRKNSSLRRWLDICSDNLTGSGSYRTLINLLRKFLGDYLIAS
YLNVVQESGFDDGYIKEIERAVLLKTLDCYWRDHLVNMNKLSSAVNVRSFAHRNPLEEYK
IDGCRFFISMLSATRRLTVESILQYWSSPMESQELFIS
Download sequence
Identical sequences D8WUA4
NP_001185059.1.80155 AT1G21650.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]