SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G22310.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G22310.1
Domain Number 1 Region: 238-290
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000327
Family Methyl-CpG-binding domain, MBD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G22310.1
Sequence length 425
Sequence
MSPLVAGNRHFSVSALRATLNHRRNLLRRNVRETILPVKNKRKSRRFSDLCSMSIRIRVK
RKKTKERKSSKITKGTSGNKIKRKRGRPRKIRNPSEENEVLDLTGEASTYVFVDKTSSNL
GMVSRVGSSGISLDSNSVKRKRGRPPKNKEEIMNLEKRDSAIVNISAFDKEELVVNLENR
EGTIVDLSALASVSEDPYEEELRRITVGLKTKEEILGFLEQLNGEWVNIGKKKKVVNACD
YGGYLPRGWRLMLYIKRKGSNLLLACRRYISPDGQQFETCKEVSTYLRSLLESPSKNQHY
YLQSDNKTLGQQPVIANESLLGNSDSMDSETMQYLESGRTSSEVFEEAKAVENGNEADRV
KTSLMQKDDNADFLNGVEDNDDDMKKRDGNMENLATLSNSEMTKSLPTTTNELQQYFSSQ
INRVQ
Download sequence
Identical sequences NP_850949.1.80155 AT1G22310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]