SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G29800.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G29800.1
Domain Number 1 Region: 180-256
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.32e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G29800.1
Sequence length 510
Sequence
MDERDREIRASHGDSNAGNVVSQSIENTREEDSGSCEGFVEESKRLEPEQQKHGKYFFYD
TPLSEETGVWIPVSVPPMLEPDHEEWSRGLSFNGGYFPEGDMGWDQIFDEDKELTMWDVI
VDMLLAARGKASALSSGNLERCGINFLSGHLLEQAWQDMAHTLTEANFGNAREILETEPP
KWLPDSAASACMLCSVRFHPIMCSRHHCRYCGGIFCRDCSKGKSLVPVKFRVSDPQRVCD
VCFVRLESVQPYLMDQVSPAAQLPTHDLTDLSTLRSWVNFPWGQSMEYEIYKATNTLRGY
ITKVGSSRTERSIPDAILRQAKGLAVITVARVGVMVTYKIGTGLVVARRDDGSWSPPSAI
SSFGLGWGAQAGGEFIDFIIVLRTREAIQTFGSNTHLVVGAGLSAAVGVTGRAVEADIRA
GSGGYAACYTYSCSKGAFVGCSLEGSIFTTRTSENSRFYGSQSLAASDILLGSLPRPPAA
AALYRALGDLYQKMGSETVRSPAISPLSED
Download sequence
Identical sequences Q84WW7
NP_174273.3.80155 AT1G29800.1 AT1G29800.1 3702.AT1G29800.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]