SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G30070.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G30070.1
Domain Number 1 Region: 69-176
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3.14e-25
Family Co-chaperone p23-like 0.068
Further Details:      
 
Domain Number 2 Region: 3-37
Classification Level Classification E-value
Superfamily Calcyclin-binding protein-like 0.0000222
Family Siah interacting protein N terminal domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G30070.1
Sequence length 222
Sequence
MAEEVGLDLEELRQLQNIAKRPRVLNLINSEISNLEKLRDSAVSSNAKPKVPVTVPAPVS
SSGKPVSSSALNYVTLGTFSWDQDNDKVKMYISLEGVDEDKVQAEFKPMSLDIKIHDVQG
KNYRCAIPKLCKEIMPEKCKVLVKPKRIVITMVKSSRGNWLDIHHKEDKIKPSLEKEKDP
MAGIMGMMKNLYEDGDEEMKKTIAKAWTDARSGKAADPLKGL
Download sequence
Identical sequences Q9C8R4
AT1G30070.1 3702.AT1G30070.1-P NP_564346.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]