SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G43171.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G43171.1
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000667
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G43171.1
Sequence length 112
Sequence
MLDELDGAMIISKTLTKTDIVGNVALPKAQVMSVLTRMNGVTDEGLDNGFEVQVHDIMED
DLYTVTLKRIDDMKYYFGTGWSTMKHSLDLVEGDVLKLYWDQFENKFIVLNF
Download sequence
Identical sequences Q1G3Z6
AT1G43171.1 NP_001117429.1.80155 AT1G43171.1 3702.AT1G43171.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]