SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G43770.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G43770.2
Domain Number 1 Region: 7-56
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000391
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G43770.2
Sequence length 431
Sequence
MSLHVKGPVCQTCGDIGFEEALVFCDSCMFESIHRYCLGITPIPFTEYITWICEDCDNSE
SDSDCNEVDQTVKKKKKSRNQPLVVLAEDNVLQEPLEGSKREESSCSRKPHELTCLDGNG
ESVLEAADSSSVPDHSSCTSKRKEVDQTANLGHILERSEKKKKKKKKKKSINHSPPVLAV
EDHELQGTTNVVEPVEVSSSSPTKETMESKRQESSDSRKPHELTCLVGDSETANSSSVPE
HNSCAVKKRKLSSGNKQIQLADGSSSCRVAESNMPLTLTSRNYRAQPIKIPIWRGLMSVK
GGNSCTMDGIVAHVSSLACPKVHETASSLKGRLSAEILPRLEVWPKTFLKNGGPKDESVA
LFFFPSSESNDEKVFDSLVDKMKKNDSAMRCVLNDAELLLFTSYMLPKDSWTFNSKYYLW
GVFKPRQTSRY
Download sequence
Identical sequences B3H578
AT1G43770.2 3702.AT1G43770.2-P NP_001117432.1.80155 NP_001320439.1.80155 AT1G43770.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]