SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G48090.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G48090.1
Domain Number 1 Region: 2644-2769
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000524
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Weak hits

Sequence:  AT1G48090.1
Domain Number - Region: 888-984
Classification Level Classification E-value
Superfamily PH domain-like 0.000639
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G48090.1
Sequence length 4146
Sequence
MFEAHFDVVILASMRAAMVAVTGEVLHLLRRYLGEYVHGLSTEALRISVWKGDVVLKDLK
LKAEALNSLKLPVAVKSGFVGTITLKVPWKSLGKEPVIVLIDRVFVLAYPAPDDRTLKEE
DREKLLETKLQQIEEAETATLEARAKSKLGSPPQGNSWLGSIIATIIGNLKVSISNVHIR
YEDSTSNPGHPFAAGITLAKLAAVTMDEEGNETFDTSGALDKLRKFKGSSPRGFKYNKNI
DWAFKMNSLQLERLALYHDSNSFPWEIEKQWDNITPEEWIEMFEDGIKEQTEHKIKSKWA
LNRHYLLSPINGSLKYHRLGNQERNNPEIPFERASVILNDVNVTITEEQYHDWIKLVEVV
SRYKTYIEISHLRPMVPVSEAPRLWWRFAAQASLQQKRLCYRFSWDSIHHLCQLRRRYIQ
LYANFLQQSSDVNYPEMREIEKDLDSKVILLWRLLAHAKVESVKSKEAAEQRKLKKGGWF
SFNWRTEAEDDPEVDSVAGGSKLMEERLTKDEWKAINKLLSHQPDEEMNLYSGKDMQNMT
HFLVTVSIGQGAARIVDINQTEVLCGRFEQLDVTTKFRHRSTQCDVSLRFYGLSAPEGSL
AQSVSSERKTNALMASFVNAPIGENIDWRLSATISPCHATIWTESYDRVLEFVKRSNAVS
PTVALETAAVLQMKLEEVTRRAQEQLQIVLEEQSRFALDIDIDAPKVRIPLRASGSSKCS
SHFLLDFGNFTLTTMDTRSEEQRQNLYSRFCISGRDIAAFFTDCGSDNQGCSLVMEDFTN
QPILSPILEKADNVYSLIDRCGMAVIVDQIKVPHPSYPSTRISIQVPNIGVHFSPTRYMR
IMQLFDILYGAMKTYSQAPVDHMPDGIQPWSPTDLASDARILVWKGIGNSVATWQSCRLV
LSGLYLYTFESEKSLDYQRYLCMAGRQVFEVPPANIGGSPYCLAVGVRGTDLKKALESSS
TWIIEFQGEEKAAWLRGLVQATYQASAPLSGDVLGQTSDGDGDFHEPQTRNMKAADLVIT
GALVETKLYLYGKIKNECDEQVEEVLLLKVLASGGKVHLISSESGLTVRTKLHSLKIKDE
LQQQQSGSAQYLAYSVLKNEDIQESLGTCDSFDKEMPVGHADDEDAYTDALPEFLSPTEP
GTPDMDMIQCSMMMDSDEHVGLEDTEGGFHEKDTSQGKSLCDEVFYEVQGGEFSDFVSVV
FLTRSSSSHDYNGIDTQMSIRMSKLEFFCSRPTVVALIGFGFDLSTASYIENDKDANTLV
PEKSDSEKETNDESGRIEGLLGYGKDRVVFYLNMNVDNVTVFLNKEDGSQLAMFVQERFV
LDIKVHPSSLSVEGTLGNFKLCDKSLDSGNCWSWLCDIRDPGVESLIKFKFSSYSAGDDD
YEGYDYSLSGKLSAVRIVFLYRFVQEVTAYFMGLATPHSEEVIKLVDKVGGFEWLIQKDE
MDGATAVKLDLSLDTPIIVVPRDSLSKDYIQLDLGQLEVSNEISWHGCPEKDATAVRVDV
LHAKILGLNMSVGINGSIGKPMIREGQGLDIFVRRSLRDVFKKVPTLSVEVKIDFLHAVM
SDKEYDIIVSCTSMNLFEEPKLPPDFRGSSSGPKAKMRLLADKVNLNSQMIMSRTVTILA
VDINYALLELRNSVNEESSLAHVALEGLWVSYRMTSLSETDLYVSVPKVSVLDIRPNTKP
EMRLMLGSSVDASKQASSESLPFSLNKGSFKRANSRAVLDFDAPCSTMLLMDYRWRASSQ
SCVLRVQQPRILAVPDFLLAVGEFFVPALRAITGRDETLDPTNDPITRSRGIVLSEPLYK
QTEDVVHLSPRRQLVADSLGIDEYTYDGCGKVISLSEQGEKDLNVGRLEPIIIVGHGKKL
RFVNVKIKNGSLLSKCIYLSNDSSCLFSPEDGVDISMLENASSNPENVLSNAHKSSDVSD
TCQYDSKSGQSFTFEAQVVSPEFTFFDGTKSSLDDSSAVEKLLRVKLDFNFMYASKEKDI
WVRALLKNLVVETGSGLIILDPVDISGGYTSVKEKTNMSLTSTDIYMHLSLSALSLLLNL
QSQVTGALQSGNAIPLASCTNFDRIWVSPKENGPRNNLTIWRPQAPSNYVILGDCVTSRA
IPPTQAVMAVSNTYGRVRKPIGFNRIGLFSVIQGLEGDNVQHSHNSNECSLWMPVAPVGY
TAMGCVANIGSEQPPDHIVYCLSIWRADNVLGAFYAHTSTAAPSKKYSPGLSHCLLWNPL
QSKTSSSSDPSSTSGSRSEQSSDQTGNSSGWDILRSISKATSYHVSTPNFERIWWDKGGD
LRRPVSIWRPVPRPGFAILGDSITEGLEPPALGILFKADDSEIAAKPVQFNKVAHIVGKG
FDEVFCWFPVAPPGYVSLGCVLSKFDEAPHVDSFCCPRIDLVNQANIYEASVTRSSSSKS
SQLWSIWKVDNQACTFLARSDLKRPPSRMAFAVGESVKPKTQENVNAEIKLRCFSLTLLD
GLHGMMTPLFDTTVTNIKLATHGRPEAMNAVLISSIAASTFNPQLEAWEPLLEPFDGIFK
LETYDTALNQSSKPGKRLRIAATNILNINVSAANLETLGDAVVSWRRQLELEERAAKMKE
ESAASRESGDLSAFSALDEDDFQTIVVENKLGRDIYLKKLEENSDVVVKLCHDENTSVWV
PPPRFSNRLNVADSSREARNYMTVQILEAKGLHIIDDGNSHSFFCTLRLVVDSQGAEPQK
LFPQSARTKCVKPSTTIVNDLMECTSKWNELFIFEIPRKGVARLEVEVTNLAAKAGKGEV
VGSLSFPVGHGESTLRKVASVRMLHQSSDAENISSYTLQRKNAEDKHDNGCLLISTSYFE
KTTIPNTLRNMESKDFVDGDTGFWIGVRPDDSWHSIRSLLPLCIAPKSLQNDFIAMEVSM
RNGRKHATFRCLATVVNDSDVNLEISISSDQNVSSGVSNHNAVIASRSSYVLPWGCLSKD
NEQCLHIRPKVENSHHSYAWGYCIAVSSGCGKDQPFVDQGLLTRQNTIKQSSRASTFFLR
LNQLEKKDMLFCCQPSTGSKPLWLSVGADASVLHTDLNTPVYDWKISISSPLKLENRLPC
PVKFTVWEKTKEGTYLERQHGVVSSRKSAHVYSADIQRPVYLTLAVHGGWALEKDPIPVL
DISSNDSVSSFWFVHQQSKRRLRVSIERDVGETGAAPKTIRFFVPYWITNDSYLPLSYRV
VEIEPSENVEAGSPCLTRASKSFKKNPVFSMERRHQKKNVRVLESIEDTSPMPSMLSPQE
SAGRSGVVLFPSQKDSYVSPRIGIAVAARDSDSYSPGISLLELEKKERIDVKAFCKDASY
YMLSAVLNMTSDRTKVIHLQPHTLFINRVGVSICLQQCDCQTEEWINPSDPPKLFGWQSS
TRLELLKLRVKGYRWSTPFSVFSEGTMRVPVPKEDGTDQLQLRVQVRSGTKNSRYEVIFR
PNSISGPYRIENRSMFLPIRYRQVEGVSESWQFLPPNAAASFYWENLGRRHLFELLVDGN
DPSNSEKFDIDKIGDYPPRSESGPTRPIRVTILKEDKKNIVRISDWMPAIEPTSSISRRL
PASSLSELSGNESQQSHLLASEDSEFHVIVELAELGISVIDHAPEEILYMSVQNLFVAYS
TGLGSGLSRFKLRMQGIQVDNQLPLAPMPVLFRPQRTGDKADYILKFSVTLQSNAGLDLR
VYPYIDFQGRENTAFLINIHEPIIWRIHEMIQQANLSRLSDPNSTAVSVDPFIQIGVLNF
SEVRFRVSMAMSPSQRPRGVLGFWSSLMTALGNTENMPVRISERFHENISMRQSTMINNA
IRNVKKDLLGQPLQLLSGVDILGNASSALGHMSQGIAALSMDKKFIQSRQRQENKGVEDF
GDIIREGGGALAKGLFRGVTGILTKPLEGAKSSGVEGFVSGFGKGIIGAAAQPVSGVLDL
LSKTTEGANAMRMKIAAAITSDEQLLRRRLPRAVGADSLLRPYNDYRAQGQVILQLAESG
SFLGQVDLFKVRGKFALTDAYESHFILPKGKVLMITHRRVILLQQPSNIMGQRKFIPAKD
ACSIQWDILWNDLVTMELSDGKKDPPNSPPSRLILYLKAKPHDPKEQFRVVKCIPNSKQA
FDVYSAIDQAINLYGQNALKGMVKNKVTRPYSPISESSWAEGASQQMPASVTPSSTFGTS
PTTSSS
Download sequence
Identical sequences F4HWS2
NP_175242.7.80155 AT1G48090.1 AT1G48090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]