SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G49480.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G49480.1
Domain Number 1 Region: 122-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-22
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G49480.1
Sequence length 226
Sequence
MQMDSAQNQFNKRARLFEDPELKDAKVIYPSNPESTEPVNKGYGGSTAIQSFFKESKAEE
TPKVLKKRGRKKKNPNPEEVNSSTPGGDDSENRSKFYESASARKRTVTAEERERAVNAAK
TFEPTNPYFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKLQLGEKQWPVRCLYKAG
RAKFSQGWYEFTLENNIGEGDVCVFELLRTRDFVLEVTAFRVNEYV
Download sequence
Identical sequences Q9XIB5
NP_001322051.1.80155 NP_001322052.1.80155 NP_564547.1.80155 AT1G49480.1 AR341 GO.515 3702.AT1G49480.1-P AT1G49480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]