SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G50190.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G50190.1
Domain Number 1 Region: 313-413
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.15e-17
Family C1-like domain 0.017
Further Details:      
 
Domain Number 2 Region: 437-523
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.72e-17
Family C1-like domain 0.037
Further Details:      
 
Domain Number 3 Region: 144-200
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000611
Family C1-like domain 0.057
Further Details:      
 
Domain Number 4 Region: 46-87,123-133
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000244
Family C1-like domain 0.066
Further Details:      
 
Weak hits

Sequence:  AT1G50190.1
Domain Number - Region: 211-250
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0403
Family PHD domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G50190.1
Sequence length 619
Sequence
MDGSKSKPLCRMSDLAKPHKLGRRFDPPLTVCISCKGQQYTGNRRGYYYYCATCDLEFHK
GCYLFPPEIKHPFHLIHPLTLTFLDHNLVSSAIPEIWFLLSTEYPYKHMFGDEEECASDG
NHKRCNSCRKKITYRDPDYPSFFDITYYHCSICNFSLHSSCVKDSPPHTIENLKSHEHTL
TLFPRLLPLPCDACGFSLDARNDSVYSFAVPSGDELSCGVCRKLVDVNYGQYACKKGCHY
AVHSKCATKNEVWDGKDLDGVPEEEEEEIEPFVRIDEETIQHFSHDHHYLKIHHGNDNHE
NKFCQACILRITVSDSFYSCVQCDFVIHETCAGLPRIKHHPLHKHPLTLYHLHYPHLNEV
QSKYYDLGFFACSGCSRECCGFMYKCCEKDCDFQLDARCASLPDPIIHDCHPHDHPLFFN
LTEGECMVCKITSGLRKYLECIECRSFSCLTCATMPLVAHYKYDKHPLTLCCGEEKTKDL
QYWCEICESEIDAQKWFYTCSYCSVTLHVTCLLGDKVYMKPNHMIKMYEGAKTSIGIVPN
SGNSRPMCDGCRSRCVDTLVVKTKMNYARDELDGAMIISKTLTKSDIVGNVALPKAQVMS
VLTRMNGVTDEGLDNGFEV
Download sequence
Identical sequences F4I4Z0
AT1G50190.1 AT1G50190.1 3702.AT1G50190.1-P NP_175438.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]