SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G51270.4 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G51270.4
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily PapD-like 6.8e-37
Family MSP-like 0.0032
Further Details:      
 
Domain Number 2 Region: 186-325
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.44e-25
Family Toll/Interleukin receptor TIR domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G51270.4
Sequence length 467
Sequence
MSTDELLTFDHVDIRFPIELNKKVSCSLNLTNKTENYVAFKAKTTNAKKYYVRPNVGVVL
PRSSCEVLVIMQALKEAPADMQCRDKLLFQCKVVEPETTAKDVTSEMFSKEAGHPAEETR
LKVMYVTPPQPPSPVQEGTEEGSSPRASVSDNGNASEAFVDMLRSLLVPLFSNAASSTDD
HGITLPQYQVFINFRGDELRNSFVGFLVKAMRLEKINVFTDEVELRGTNLNYLFRRIEES
RVAVAIFSERYTESCWCLDELVKMKEQMEQGKLVVVPVFYRLNATACKRFMGAFGDNLRN
LEWEYRSEPERIQKWKEALSSVFSNIGLTSDIRSNESKFVDSIVEEVKKVLIKIADNFFK
DHLPWKFPRLTLTDGTTIYIKRSYFVGFLVQETANVSLDDHDLRDSPLVTNYVCFTTPIN
DLLKFHTLLISLSHKVSSKVHHSSLFFATMYLFEFESFTFIVWLSPT
Download sequence
Identical sequences AT1G51270.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]