SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G51970.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G51970.1
Domain Number 1 Region: 16-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000647
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G51970.1
Sequence length 124
Sequence
MAQELDLELGLAPYDPWVLKKNLTESDLNNGFIILPKQDFEKIIRQMERGLVKNLGNGVE
VKVHIIEEGPESDDYTLTLVKCRGNCMFRGGWYNMVKAKCYKPDDEIGLMWDKWSRRFLF
HHIN
Download sequence
Identical sequences Q9ZU26
NP_175609.1.80155 3702.AT1G51970.1-P AR366 GO.4803 AT1G51970.1 AT1G51970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]