SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G52380.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G52380.1
Domain Number 1 Region: 291-413
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-30
Family Ran-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G52380.1
Sequence length 440
Sequence
MGDSENVQQPSKKRGALKQLSRDNPGLDDDDDSAELESGTFKKASDEVLASRRIVRVKRK
EPSAAPVAASNPFAGIQLVPTTAPASTPVGTNAPLAESKLAPAEAVVEDNQKASDIEEGD
EVDSKKVDVKDAVGEETEKTKDKDDNHCGKSADVQVAATEVAQMVSCDTNVCNNAVEGTD
QTDFPLEKDSGGDQAEKKEKEGNGIEEADKNGDNGAFSSFQQHSSNKNAFTGLASTEASG
SSFSFGLVSQDGSTGTGSLFGFGLPSSNSSSIFGATGSSIIKKSEGSGFPPKQEVSTETG
EENEKVAFSADSIMFEYLDGGWKERGKGELKVNVSSNDGKARLVMRAKGNYRLILNASLY
PEMKLANMDKKGITFACVNSVSEGKEGLSTFALKFKDPTIVEEFRVAIDKHKDSKPMEKA
AEKSALPLKTPENSPTATDT
Download sequence
Identical sequences Q9C829
AT1G52380.1 NP_001322286.1.80155 NP_001322287.1.80155 NP_001322288.1.80155 NP_564606.1.80155 3702.AT1G52380.1-P AT1G52380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]