SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G52500.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G52500.1
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.53e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 146-232
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.28e-27
Family Middle domain of MutM-like DNA repair proteins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G52500.1
Sequence length 274
Sequence
MPELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGK
NLWLELDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDSEEWPSKYSKFFVELDDGLEL
SFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGY
ISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIQHAVQVNADSKEFPVEW
LFHFRWGKKAGKVNGKLSHHLSINLMKQNLGFCR
Download sequence
Identical sequences AT1G52500.1 NP_001322993.1.80155 NP_849798.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]