SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G54390.4 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G54390.4
Domain Number 1 Region: 189-257
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.43e-21
Family PHD domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G54390.4
Sequence length 262
Sequence
MAIARTGVYVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSS
KKGNGNHYNNGGLDEEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDE
DLNNFAEDLKQEGKIPPDEPSVLPPLPIVPKAEKRKSFYGTPQPKKIDYRDRDWDRDRDF
ELMPPPGSNRKDLMPIEEQPIDPNEPTYCVCHQVSFGDMIACDNENCQGGEWFHYTCVGL
TPETRFKGKWYCPTCRLLPQSH
Download sequence
Identical sequences A0A178WC19 B3H615
NP_974026.1.80155 NP_974027.1.80155 AT1G54390.3 AT1G54390.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]