SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G55380.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G55380.1
Domain Number 1 Region: 169-263
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.4e-22
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.042
Further Details:      
 
Domain Number 2 Region: 373-475
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.54e-19
Family C1-like domain 0.01
Further Details:      
 
Domain Number 3 Region: 495-585
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.62e-16
Family C1-like domain 0.018
Further Details:      
 
Domain Number 4 Region: 50-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000889
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.045
Further Details:      
 
Weak hits

Sequence:  AT1G55380.1
Domain Number - Region: 273-310
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0345
Family PHD domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G55380.1
Sequence length 661
Sequence
MEPLPPYFSRAKPPCRLSDPAQPHMLCRRRRPSHPPLSICFSCKGKQLKRNNYYYYCATC
NLEFHRGCHIFLPEIRHPFHPSHPLTFISLLLPKFDVTKIPKNWMDSSSSSDESEDDDDD
EKSIKEECEDDGDDDDGDSSDSDDDDNNFDANNDGASLSDGNHLKCKCCQVPLEKIYYHC
SICKFNLNVECSMRPPPTTISHLKSHEHILTLFPIRLPLPCGACGLSLSDAEDLVYACLP
CNLLVHRSCIYLPRVIKITRHPHRLSLTPSLQPGDFSCGVCRQTVDVNYGQYSCDKECHY
AVHSKCATRNDVWDGKDLDGVPEEPDEFIEPPFLKIDEETIQHFSHHHHLKLHEKKTIGG
KDKFCEACTLPVMISQRYYGCMQCDFVLDETCASLPRKKNHPLHKHPLNLHILPLGESAM
INKGATSKDIFQCIGCGRIGCGFFYKCDEKDCDEFLLDVRCASLPDPFVHDCHPHDHPLF
FNLTKGNCMGCGSDNCSSYFLECIKCKSFLGIKCATLPCEAHYIHDRHPITLCYGEEDTT
SGQYWCEICELKLDPKTWFYSCDFCKITLHVNCLLGEDIYLKPCHIFKVGLYYKEVEIAR
NDGNSRLFCYTCELRCGQTLVFKYIGGCKSFCTLRCIGNYFDAKDGWVYDAARNLNIFRR
I
Download sequence
Identical sequences Q9C6G7
AT1G55380.1 NP_175935.1.80155 AT1G55380.1 3702.AT1G55380.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]