SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G55420.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G55420.1
Domain Number 1 Region: 208-302
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.19e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.042
Further Details:      
 
Domain Number 2 Region: 412-514
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.07e-19
Family C1-like domain 0.0097
Further Details:      
 
Domain Number 3 Region: 535-625
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-16
Family C1-like domain 0.023
Further Details:      
 
Domain Number 4 Region: 49-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000136
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.045
Further Details:      
 
Weak hits

Sequence:  AT1G55420.1
Domain Number - Region: 651-683
Classification Level Classification E-value
Superfamily Tim10-like 0.0405
Family Tim10/DDP 0.0099
Further Details:      
 
Domain Number - Region: 311-349
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0921
Family PHD domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G55420.1
Sequence length 725
Sequence
MEPPPPHFSRAKPPCRLSDPAQPHKLCRRRRPSYPPLSICFTCKGKQLRSSAYYYYCATC
NLEFHRGCHIFLPVIRSSFHPSHPLTFFSSDPKFDVSIIPKYWRDSSATEESSDESINQL
TIEYLGDVSDDDGEDSHSDHDLGASEDDGEDSHSDHDLGASDDDGEDSHSDHDLGARDDD
GNGNGAGDVHADGEASLSDGNHLKCKCCGVPLQMTYYHCSICKFNLNLDCSMRQPPPIIS
HLKSHEHTLTLFPIRLPLPCDACGLSLNDTEDLVYSCLPCSRMVHRSCIYLPRVIKITRH
QHRLSHTSSLQPGDFSCGVCRQTVDVNYGQYSCNKECHYAVHSKCATRNDVWDGKDLDGV
PEEPDEFIEPPFLKIDEETIQHFSHHHYLKLHEKKTIYKRDKFCEACTLPVMISQRFYGC
MQCDFVLDETCASLPRKKNHPLHKHPLNLHTLPLGESAMINKGATSKDIFKCIGCGRIGC
GFYYKCDEKNCDEFLLDVRCASLPDPFVHDCHPHDHPLFFNLTKGNCMGCGSDSCSSYFL
ECIKCKSFLGIKCATLPCEAHYTHDRHPLTLCYEEEEDTTSGQYWCEICEFKLDPKTWFY
TCDYCMITLHVNCLLGKDIYLKPCHIFKVGLFYKEVEIARNDGNSRLFCYICRLRCGQTL
VFKWLGRRKSFCTLRCIGKYVKDTRGYYDAVAMGYFESYPTNLVTSPEASDSSVIKSAFD
FLFRD
Download sequence
Identical sequences Q9ZVU2
3702.AT1G55420.1-P NP_564688.1.80155 AT1G55420.1 AT1G55420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]