SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G55750.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G55750.1
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000123
Family TFIIH domain 0.022
Further Details:      
 
Domain Number 2 Region: 116-162
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000000000549
Family BSD domain 0.0025
Further Details:      
 
Domain Number 3 Region: 195-245
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000183
Family BSD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G55750.1
Sequence length 591
Sequence
MAGGQIEKLVKYKSTVKDPGTPGFLRIREGMLLFVPNDPKSDSKLKVLTQNIKSQKYTKE
GSNKPPWLNLTNKQAKSHIFEFENYPDMHACRDFITKALAKCELEPNKSVVSTSSEQLSI
KELELRFKLLRENSELQRLHKQFVESKVLTEDEFWATRKKLLGKDSIRKSKQQLGLKSMM
VSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSKMTEKDFWTKYFRAEY
LYSTKNTAVAAAEAAEDEELAVFLKPDEILARETRHKIRRVDPTLDMEADQGDDYTHLMD
HGIQRDGTMDVVEPQNDQFKRSLLQDLNRHAAVVLEGRSIDVESEDTRIVAEALTRVKQV
SKADGETTKDANQERLERMSRVAGMEDLQAPQNFPLAPLSIKDPRDYFESQQGNVLNVPR
GAKGLKRNVHEAYGLLKESILEIRATGLSDPLIKPEVSFEVFSSLTRTIATAKNINGKNP
RESFLDRLPKSTKDEVLHHWTSIQELLKHFWSSYPITTTYLHTKVGKLKDAMSNTYSKLE
AMKESVQSDLRHQVSLLVRPMQQALDAAFHHYEVDLQRRTAKSGERPNGYV
Download sequence
Identical sequences Q3ECP0
AT1G55750.1 3702.AT1G55750.1-P NP_001319242.1.80155 NP_175971.3.80155 AT1G55750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]