SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G55970.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G55970.1
Domain Number 1 Region: 1344-1422
Classification Level Classification E-value
Superfamily TAZ domain 1.57e-19
Family TAZ domain 0.00035
Further Details:      
 
Domain Number 2 Region: 411-500
Classification Level Classification E-value
Superfamily TAZ domain 3.92e-19
Family TAZ domain 0.002
Further Details:      
 
Domain Number 3 Region: 1140-1197
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000647
Family ZZ domain 0.015
Further Details:      
 
Domain Number 4 Region: 1262-1335
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000129
Family ZZ domain 0.0059
Further Details:      
 
Domain Number 5 Region: 802-847
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000155
Family PHD domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G55970.1
Sequence length 1456
Sequence
MNNNKEVPQNSVAVSSSSSAPITVISPQQDANNFIKKRRTALRNRIYAIVRHKQKQHQIF
LDKKNQQQQQRVDDATQRALLEKQDQQCIAATRMIEEELLKSSRSFEEYFDLRTFDARVR
TILQQLGTMLSQRRAAAAAMNNGEAQCITSTRAVHTSISVSNSFQCGRSLVPINCTTATA
GAFSIGPDMQTHHSTGANHQMVEVNRPNMNQITCGISSPLITGFNGNCVPVSANIPMTSQ
DLFNATHFSTLPQPFLQPPPDQSHMHRYSMSNVASFGQSNPYPCGVVMSSGSMAVAQNSI
PWNNPNPMQGLDPTVTSYHSNLQPMQQTPLPKRQLHHPLWNTNFQSAPNNRDNLPQVSQQ
LSNHGSRQHRGQHSQNLYPGQLQNQDRLLPNLTQQAMALAAPVMHVPSKQVNEDCGQTSS
NTVLRWIPFMFHARHCKAKKDKCASKFCFQARKIVKHIDCCKVPNCKYRYCLGTRMWLDH
FKQCKSISCRTCVAVREYMEKNKYTIVPLRRAKCSSASSKCQPKKSSKSRQAYKKGGAEA
PSVDADLQRSIKRPKLHRPSQNITPETKSISVTGCGVVCKPHSLMNMQEKDGLQSLKVEA
MPMDIDVPGASEIPVTRELVKHVAEDTPKGNNCGGFAMVEKTSCLLAQGKSKCMNEMSAP
KEENVKQSVEVVDASKMEISSLVELFTPEQVKEHIRSLRQWVGQSKTKAEKNKAMGCSMS
VNSCQLCAVEWLVFEPVPIYCSPCGIRIKKNALHYSIAVGESRHYVCAPCYNEAREKLVF
LDGTSIPKTRLQKKKNDEQVPEGWVQCDKCEAWQHIICALFNSRRNHGESTKYTCPSCYI
QEVEQRERRPLPLSAVPGATSLPVTSLSKHLEERLFKKLKEERQERARLQGKTYEEVPGA
ESLTVRVVASVDKVLEVKERFLELFREENYPSEFPYKSKAIFLFQKIENVEVCLFGMFVQ
EFGTDSGPPNERRTFRTVSGEALRTFVYHEILIGYLDYCKKRGFTSCYIWACPPLKGDDY
ILYCHPEIQKTPKTDKLREWYLAMLRKASKEDVVVECTNLYNHFFVQSGECRANVTAARL
PYFDGDYWPSAAEDLLRQMNQEDDGETKLHRKGLTKKVISKRALKAVGQLDLSLNASKDR
LMMQKLGETICPMKEDFIMVHLQHCCKHCTTLMVSGNRWVCNHCKNFQICDKCYEVEQNR
INIERHPINQKEKHALFPVAIKDVPTKIEDKDNNLESEFFHNRQAFLNLCQGNNYQYETL
RRAKHSSMMILYHLHNPTAPAFATVCTICQQEVENSQGWHCEVCPGYDVCSACYSKDSIN
HSHKLTSRSSSTDSTVVQQNGQASQSYQVKLEKLKKLLVHAATCRSTQCQYQGCRKSKML
FRHCIDCTTGDCPICKGLWSLLKLHARNCRDSKCTVPKCSGLRAISRRKQQQADKRRRAA
VMEMMRERAAEATRTG
Download sequence
Identical sequences A0A1P8AQG0
AT1G55970.1 NP_564706.1.80155 3702.AT1G55970.1-P AT1G55970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]