SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G57800.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G57800.1
Domain Number 1 Region: 260-451
Classification Level Classification E-value
Superfamily PUA domain-like 4.47e-57
Family SRA domain-like 0.00000532
Further Details:      
 
Domain Number 2 Region: 522-612
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000192
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 131-208
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000278
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 4 Region: 6-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000509
Family PHD domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G57800.1
Sequence length 660
Sequence
MTPATQYPCDPEGVCMRCKSMPPPEESLTCGTCVTPWHVSCLLSPPETLSATLQWLCPDC
SGETNPLPVSGVAAGYGSVGSDLVAAIHSIEADETLSAEEKAKKKQQLLSGKGVVDEDDE
EEKKKTSKGKKPIDVLSHFECSFCMQSLQKPVSVRVLFALALMLVWFLESTPCGHNACLK
CFLKWMGQGHRSCGTCRSVIPESMVTNPRINLSIVSAIRLARVSEKADARTSKVVHYVDN
EDRPDKAFTTERAKKTGNANASSGKIFVTIPRDHFGPIPAENDPVRNQGLLVGESWKGRL
ACRQWGAHFPHVSGIAGQASYGAQSVVLAGGYDDDEDHGEWFLYTGSGGRILKGNKRTNT
VQAFDQVFLNFNEALRLSCKLGYPVRVVRSTKDKRSPYAPQGGLLRYDGVYRIEKCWRIV
GIQMCRFLFVRCDNEPAPWTSDEHGDRPRPLPNVPELNMATDLFERKESPSWDFDEGEDR
WRWMKPPPASKKAVKNVLDPEERKLLREAIKSANPNTMRARLLKEFKCQICQKVMTNPVT
TPCAHNFCKACLESKFAGTALVRERGSGGRKLRSQKSVMKCPCCPTDIAEFVQNPQVNRE
VAEVIEKLKKQEEEENAKSLDEGQCSGTSHEEEDDEQPKKRIKLDTDAEVSATVVESDMK
Download sequence
Identical sequences Q9FVS2
AT1G57800.1 3702.AT1G57800.1-P NP_176091.2.80155 AT1G57800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]