SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G57820.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G57820.2
Domain Number 1 Region: 247-438
Classification Level Classification E-value
Superfamily PUA domain-like 9.94e-62
Family SRA domain-like 0.0000042
Further Details:      
 
Domain Number 2 Region: 138-203
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000619
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 509-599
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000127
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 4 Region: 8-65
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000244
Family PHD domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G57820.2
Sequence length 642
Sequence
MARDIQLPCDGDGVCMRCKSNPPPEESLTCGTCVTPWHVSCLSSPPKTLASTLQWHCPDC
SGEIDPLPVSGGATGFESAGSDLVAAIRAIEADESLSTEEKAKMRQRLLSGKGVEEDDEE
EKRKKKGKGKNPNLDVLSALGDNLMCSFCMQLPERPVTKPCGHNACLKCFEKWMGQGKRT
CGKCRSIIPEKMAKNPRINSSLVAAIRLAKVSKSAAATTSKVFHFISNQDRPDKAFTTER
AKKTGKANAASGKIYVTIPPDHFGPIPAENDPVRNQGLLVGESWEDRLECRQWGAHFPHV
AGIAGQSTYGAQSVALSGGYKDDEDHGEWFLYTGRDLSGNKRTNKEQSFDQKFEKSNAAL
KLSCKLGYPVRVVRSHKEKRSAYAPEEGVRYDGVYRIEKCWRKVGVQGSFKVCRYLFVRC
DNEPAPWTSDENGDRPRPIPNIPELNMATDLFERKETPSWDFDEGEGCWKWMKPPPASKK
SVNVLAPEERKNLRKAIKAAHSNTMRARLLKEFKCQICQQVLTLPVTTPCAHNFCKACLE
AKFAGKTLVRERSTGGRTLRSRKNVLNCPCCPTDISDFLQNPQVNREVAEVIEKLKTQEE
DTAELEDEDEGECSGTTPEEDSEQPKKRIKLDTDATVSATIR
Download sequence
Identical sequences NP_974045.1.80155 AT1G57820.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]