SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G58230.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G58230.1
Domain Number 1 Region: 1938-2226
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-121
Family BEACH domain 0.0000000155
Further Details:      
 
Domain Number 2 Region: 2338-2593
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.12e-42
Family WD40-repeat 0.0052
Further Details:      
 
Domain Number 3 Region: 449-633
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-22
Family Clostridium neurotoxins, the second last domain 0.031
Further Details:      
 
Domain Number 4 Region: 1765-1817,1860-1911
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-17
Family PreBEACH PH-like domain 0.0057
Further Details:      
 
Domain Number 5 Region: 117-287,322-389,754-831,934-960,989-1011,1092-1224
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000275
Family Armadillo repeat 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G58230.1
Sequence length 2604
Sequence
MESDSVAGSASSSDAAASHLPSVSVLLDALEQSASTPRIANGLSQRLLRSLQFSNENKLS
FKALNGACRVLRLACIQAKESRKSGCVSPLVESSDCGVIVDSPHKKSDSSHTEDCWFECV
ESCVGIFTEFFSSTNDAKVYVLRSSVCVDCLFELFWEKAVRNNVMKLIIDLMKIRPLCEE
DKSAKLQVCSKYLETFTQVKERENDSVDLSVDLLAGMRDLIKSDSRYYQALFREGECFLH
IVSLLNGNLDEANGEKLVLNVLQTLTSLLANNDTSKFAFKALAGKGYQTLQSLLLDFFQW
KPTQRLLDALLDMLVDGKFDDKGSALIKNEDVIILYLNVLQKSSESLQCYGLNLFQQLLR
DSISNRASCVRAGMLHLLLDWFSLENDDSVILKITQLTQTIGGHSISGKDIRKIFALLRS
ERVGNQQRYRSLLLACLLSMLNEKGPTGFFDMNGVESGIVIRTPVQWPANKGFSFCCWLR
VESFPGDGKMGIFSFMSKNGKGCFAALGKDGLSYVSLNLKRQCVNVHTNLVCKKWHFICV
SHSIGRAFWGGSLLRCYVNGDLVSSERCSYPKVTDVLTSCLIGTRITLPHIQDNDGLESI
RDVFPFFGQIGPVYLFNDSLSSEQVQAIYSLGPSYMYAFLENEMTCPFSDNPFPSGILDG
KDGLASKVSFGLNAQASDGRRLFNVSRVSDHLQERLAFEADIMVGTQLCSRRLLQQIIYC
VGGISVFFPLITQSDRCESETLNEETSAMPTKERMTAEVIELIASVLDENPANQQQMHLL
AGFPILGFLLQSIQPKQLNLETLSSLKHLFNVISSSGFAEQLVEDAISSIFLNPHIWLHA
AYNVQRELYMFLIQQLDNDPRLLGSLCRLPRVIDIVWNFYWESERYCKGSKPLMHPTRTI
AERPSRDEIHKIRLLLLSLGEMSLRHNISSGDVKALTAFFETCQDVACIEDVLHMVIRAI
SQTSVLVSFLEQVNLIGGCHIFVDLLQRDYEPIRLLSLQFLGRLLYDVPSERKGPKFFNL
AVGRTKSLSQGHKKIGARTQPIFLAMSDRLFQYPQTDNLRATLFDVLLGGASPKQVLQKH
NQVDKHRSKPSNSHFFLPQIFVFIFEFLSGCKDGLARMKIISDILDLLDSNPMNVEALME
FGWSAWLTASMKLDVIKDYRSELLNHDDLALNEQHFVRGLFCVVLCHYILSVKGGWQQLE
ETVNFILLQSEHNDVPYRSFLRDLYEDLIQRLVELSSEDNIFLSHPCRDNVLYLLRLVDE
MLVREFGSRLLFPAISTDFSEDLLQLGNREDPTLGLDESFQRFLTEEISRNTECQQSCTT
VTELMTNERWWNLYDNLWKIICDINGRGPVKMSPKSLATGPSIGQRARGLVESLNVPAAE
MAAVVVSGGIGSALSGKMNKNVDKAMLLRGEKCPRIVFRLVTLYLCMSSLEKATRCVQQV
TSLLPSFLAADDEQSKSRLHLFIGCLLYVRSQYGKLDDGARFHVISHLIRETVSCGKSIL
ATSGMNKDDSSDSGGIFKEMGSIQNLIHKDRVLAAVTDETTYMKTLISDRTRQVQALGER
NNETLSIECNSKKAFDGELQNVLKTVVTWDENRRVSVQLSHEEQQQNVTEKWIHMLRSLM
DERGPWSATPFPNNILNRWKLDRTEDSWRRRPKLRRNYHFDERLCHPPSTSTATENETSN
VINESKSGVIHIPEQMKKFLLKGIRRITDEGGSDSCENDSSQAEQSFMDTSADIQFSELV
RTSSGLKDVVQDKVDASSLEVGTSEVLTSVPCVLVTPKRKLAGWLAVMKNVLHFSGEFLV
EGTGGSAVFKNFSTSKGSDVTKAENKQNLVKWSSPYDSETFLDLESGNKNKKPLKKVKRH
RRWKIGKVKSVHWTRYLLQYTALEIFFQESVPPVFLNFASQKNAKEVGMLIVSTRNEFLF
PKNVPRDRTAMISFVDRRIAMEMAETARDRWRRREITNFEYLMILNTLAGRSYNDLTQYP
VFPWVVADYSSETLDFSKASTFRDLSKPVGALDTRRFEIFEDRYHSFSDPDIPSFYYGSH
YSSMGSVLYYLLRLEPFTSLHRSLQGGKFDHADRLFQSVEGSFRNCLSNTSDVKELIPEF
FYMPEFLVNSNSYHLGVKQDGEPLGEVCLPPWAKGSPEMFIARNREALESEYVSSHLHDW
IDLIFGHKQRGKPAVEAANIFYYLTYEGAVDVENMEDQLQISAIEDQIANFGQTPIQIFR
KKHPRRGPPIPIAHPLYFAPASINLSSILPATTHSPSAVLYVGVVDSNIVLVNQGLTLSV
KIWLTTQLHSGGNFTFSSAQDPFFGVGSDVLSPRNIGSPLADNVELGSQCFAAMQMPLEN
FLVSCGNWENSFHVISLTDGRVVQSIRHHKDVVSCVAVTADSTILATGSYDTTVMVWDIL
RMRTPEKRVRNTHAEVLRKDIVIADAPSHILCGHDDIITCLYVSTDLDIVISGSKDGTCV
FHTLREGRYIRSLKHPSGSAVSKLAASHHGRIVLYGDDDLSLHLYSINGKHLASSESNGR
INCLELSKCGEFLVSAGDQGQIIVRSMNTLEVVKRYNGAGKIITSLTVTQEECFLAGTKD
GALLVYSIENPQHRKPSPIWSIKS
Download sequence
Identical sequences F4I9T0
AT1G58230.1 NP_564728.3.80155 AT1G58230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]