SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G59610.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G59610.1
Domain Number 1 Region: 36-312
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.49e-34
Family G proteins 0.001
Further Details:      
 
Domain Number 2 Region: 580-703
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-20
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G59610.1
Sequence length 920
Sequence
MEAIDELSQLSDSMRQAASLLADEDPDETSSSRRPATSLNVVALGNVGAGKSAVLNSLIG
HPVLPTGENGATRAPIIIDLSREESLSSKAIILQIDNKNQQVSASALRHSLQDRLSKGAS
GRGRDEIYLKLRTSTAPPLKLIDLPGLDQRIVDDSMIGEHAQHNDAILLVVVPASQASEI
SSSRALKIAKEYDPESTRTVGIISKIDQAAENPKSLAAVQALLSNQGPPKTTDIPWVALI
GQSVSIASAQSGGSENSLETAWRAESESLKSILTGAPQSKLGRIALVDTLASQIRSRMKL
RLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELCREFEDKFLLHLAGGEGSG
WKVVASFEGNFPNRIKKLPLDRHFDLNNVKRIVLEADGYQPYLISPEKGLRSLIKTVLEL
AKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVV
ALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLNRATSPQPDGPS
STGGSLKSLRDKLMPQDKDKDKEKETPEVSGLKTAGPEGEITAGYLMKKSAKTNGWSRRW
FVLNEKTGKLGYTKKQEERNFRGTVTLEECSIEEISDDEGEKSKSSKDKKSNGPDSKGPG
LVFKITCRVPYKTVLKAHNALVLKAESMVDKNEWINKLQKVIQARGGQVGSASMRQSLSE
GSLDKMVRKPVDPEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKSKEDMLNQLY
SSISAIGNERIESLIQEDQNVKRRRDRYQKQSSLLSKLTRQLSIHDNRAAAASSWSDNSG
TESSPRTNGGSSGEDWMNAFNAAASGPDSLKRYGSGGHSRRYSDPAQNGEDSSGSGGSSR
RTTPNRLPPAPPQSGSSYRY
Download sequence
Identical sequences G1JSJ5 Q9LQ55
AT1G59610.1 3702.AT1G59610.1-P AT1G59610.1 NP_176170.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]