SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G59750.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G59750.2
Domain Number 1 Region: 113-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-44
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 541-616
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000262
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G59750.2
Sequence length 662
Sequence
MAASNHSSGKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGL
EQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCT
VHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIF
RGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNIPSSVISSH
SMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEG
EEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANST
PSSQPQPPQRNKRPRPPGLPSPATGPSGPDGVWKSPADTPSSVPLFSPPAKAATFGHGGN
KSFGVSIGSAFWPTNADSAAESFASAFNNESTEKKQTNGNVCRLFGFELVENVNVDECFS
AASVSGAVAVDQPVPSNEFDSGQQSEPLNINQSDIPSGSGDPEKSSLRSPQESQSRQIRS
CTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLESTKKWQVVYTDDEDDMMM
VGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKLAVNARMQLKADAEENGNTEGRSSSMAG
SR
Download sequence
Identical sequences NP_849830.1.80155 AT1G59750.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]