SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G60860.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G60860.1
Domain Number 1 Region: 7-242,288-313
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.36e-61
Family BAR domain 0.00081
Further Details:      
 
Domain Number 2 Region: 467-598
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.59e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.0004
Further Details:      
 
Domain Number 3 Region: 285-424
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-23
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 684-762
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-20
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G60860.1
Sequence length 776
Sequence
MAGFINLEDSPMFQKQVFSLEGTSDELKDRCQKLYKGVKKFMGALGEASTGVSAFADSLE
EFGAGHDDPVSVSIGGPVISKFINTLRELSSYKEFLRSQVEHVLLERLTNFMTVDLQEAK
ESRRRFDKAVHSYDQAREKFVSLKKNTRGDIVAELEEDLENSKSAFEKSRFNLVNSLMTI
EAKKKYEFLESISAIMDSHFKYFKLGYDLLSQLEPYIHQVLTYAQQSKEQSKIEQDRFAQ
RIQEFRTQSELDSQQASAKADPSDVGGNHVYRAIPRKNVEANSVSTADKEVTKQGYLLKR
SASLRADWKRRFFVLDNHGSLYYYRNTGNKSAKSQHYYSGLGEHSSGVFGRFRTRHNRSA
SQGSLDCNMIDLRTSLIKLDAEDTDLRLCFRIISPQKTYTLQAENGADRMDWVNKITAAI
TIRLNSHFLQQSPARYLDKKNTSSGPATENLTLNQKEDYNQRLNVGDDVLTILREIPGNN
TCAECNAPDPDWASLNLGVLMCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFRNL
GNGYCNSVWEELLHHLDDDSEKGSTDTLASVSKPSSEDWFTLKEKYINGKYLEKALVVKD
EREANSTASSRIWEAVQSRNIRDIYRLIVKADANIINTKFDDITDLDVYHHHHVDAPDEV
KKRHDPNACQRIKNSNEARNCLQGCSLLHVACQSGDPILLELLLQFGADINMRDYHGRTP
LHHCIASGNNAFAKVLLRRGARPSIEDGGGLSVLERAMEMGAITDEELFLLLAECQ
Download sequence
Identical sequences Q9C6C3
NP_176283.1.80155 AT1G60860.1 AT1G60860.1 3702.AT1G60860.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]