SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G63240.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT1G63240.1
Domain Number - Region: 14-59
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00752
Family Methyl-CpG-binding domain, MBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G63240.1
Sequence length 548
Sequence
MLRQLPPTITADATPDWLPVGWIAHSTVLKRGRQTRTYTQLRTGKKLSTKDQVLEYIKME
KIREKREAGIKRNKASLKALQDKETASERPSWLPDERKAELEIGYVGGNPYKMNVNTSND
FNTNPKETVVLDENSMESEDSSGEVYETGCNEITYAIEEDEEDFSEREYVENVENFSNIT
STPLRSQPERMQKLESRAKTQCVFEDEDLSSDSDNKLPEAETSKEGNGLGEGHVVSNLVE
SFEKKTSHGVMVECDDKAREIPGLTGSLTVEINLDCEPASDSLVEKNWNKSESDETGTRN
IEIIDLESDVIHISGSSKAVEVTQESGDTSKEPLKAQEEPDNDWRSSVFFPDREAPSHSV
LVFESSNARPSVEDLSNTIELGLTPQEKNISSSKKRKKNTERCASKNIKKKGIEAPSRKL
QRGKTPSSKSHGKKGSSSVGMDKKPDDWLKPCPNFPFEPLTRSFQVEDDSAIRMYLEQHF
AAPGSADSNLPLPDFGLPTFSDIKISLNEEPAFKKKKSPDPPCVQVASSNIPSCSSMGTS
MLPTVAGH
Download sequence
Identical sequences A0A178WL51 Q949Y1
NP_564812.1.80155 AT1G63240.1 3702.AT1G63240.1-P AT1G63240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]