SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G63680.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G63680.1
Domain Number 1 Region: 340-574
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 8.37e-54
Family MurCDEF 0.00033
Further Details:      
 
Domain Number 2 Region: 577-749
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.82e-33
Family MurCDEF C-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 243-340
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 0.00000000000000262
Family MurE/MurF N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G63680.1
Sequence length 772
Sequence
MAFTFLSPHPVFLSLTGTTSSFSYKPVLLPFSRNSRTLTVAAGPARRNSYPNPADDDPPE
APEDSMHGVSKFQQIQRQAARARKLEEEDFEKNRNTYLSAIADVEDAAETGRDDEESGGD
LFSDIDRAISMKRSEFVKQGLLKPNPPKTASLKKIGEEGNEEEGDVTDDVDELDEEEVVD
LDEIDKLTGLTEISDEEDWVDEEGNTRINKKKEFGSDHQFEFDLDDFGESKARIVEPKFK
MCLAELLDESKVVPISVYGDLDVEITGIQHDSRGVSAGDLFVCCLGSENFLSEADKRGAV
AVVASKEIDIEDTLGCRALVIVEDTNAVLAALASSFYRHPSKNMSVIGVTGTDGKTTTTY
LIKSLYEAMGVRTGMFSTVSCYIHGDNKLDTPNATMNPDAVLVQSLMAKMLHNGTESLVM
EASPQELALGKCDEVDFDIAVFTNLTRENTDFRGTDEEYRDAEAKLFSRMVDPERHRKVV
NIDDPNAAFFVQQGNPNVPVVTFAMENTKADVHPLKFELSLFETQVLVNTPQGILEISSG
LLGRHNIYNILAAVAVGIAVGAPLEDIVRGVEEVDAVPGRCELIDEEQAFGVIVDHANTP
DGLSRLLDSIRELKPRRIITVIGCEGENERGKRPLMTKIATEKSDVTMLTSDNPRNEDPL
DILDDMLSGIGWTMQEYLKHGEHDYYPPLANGHRLFLHDIRRVAVRCAVAMGEEGDMVVV
AGKGHEAYQLEGEKKEFYDDREECREALQYVDELHQAGIDTSEFPWRLPESH
Download sequence
Identical sequences F4I3P9
3702.AT1G63680.1-P AT1G63680.1 AT1G63680.1 NP_001321888.1.80155 NP_001321889.1.80155 NP_176555.4.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]