SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G66040.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G66040.1
Domain Number 1 Region: 232-426
Classification Level Classification E-value
Superfamily PUA domain-like 4.22e-63
Family SRA domain-like 0.00000299
Further Details:      
 
Domain Number 2 Region: 126-191
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000144
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 492-581
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000619
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Domain Number 4 Region: 5-62
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000687
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G66040.1
Sequence length 622
Sequence
MAIQTQLPCDGDGVCMRCQVTPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDCS
GVVVPSAAPGTGISGPESSGSVLVAAIRAIQADVTLTEAEKAKKRQRLMSGGGDDGVDDE
EKKKLEIFCSICIQLPERPVTTPCGHNFCLKCFEKWAVGQGKLTCMICRSKIPRHVAKNP
RINLALVSAIRLANVTKCSGEATAAKVHHIIRNQDRPDKAFTTERAVKTGKANAASGKFF
VTIPRDHFGPIPAANDVTRNQGVLVGESWEDRQECRQWGVHFPHVAGIAGQAAVGAQSVA
LSGGYDDDEDHGEWFLYTGSGGRDLSGNKRVNKIQSSDQAFKNMNEALRLSCKMGYPVRV
VRSWKEKRSAYAPAEGVRYDGVYRIEKCWSNVGVQGLHKMCRYLFVRCDNEPAPWTSDEH
GDRPRPLPDVPELENATDLFVRKESPSWGFDEAEGRWKWMKSPPVSRMALDTEERKKNKR
AKKGNNAMKARLLKEFSCQICRKVLSLPVTTPCAHNFCKACLEAKFAGITQLRDRSNGVR
KLRAKKNIMTCPCCTTDLSEFLQNPQVNREMMEIIENFKKSEEEAEVAESSNISEEEEEE
SEPPTKKIKMDNNSVGDTSLSA
Download sequence
Identical sequences Q9C8E1
AT1G66040.1 NP_176778.1.80155 AT1G66040.1 3702.AT1G66040.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]