SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G66170.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G66170.1
Domain Number 1 Region: 600-664
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000332
Family PHD domain 0.00059
Further Details:      
 
Weak hits

Sequence:  AT1G66170.1
Domain Number - Region: 201-265
Classification Level Classification E-value
Superfamily TM1457-like 0.0759
Family TM1457-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G66170.1
Sequence length 704
Sequence
MPVPIIETCRKRKRKPKVYNLQRFGEDGFPIQRNGAFRDQIRVFLRDCAEIEDYDIRGMT
VWCTLLSHETKSSLIPLYIVEENVKHSSEPYCDHCRCTGWSNHFVSKRKYHFIIPIDTEW
SLPLEDDAFDSQSHVLHGLIHCNGFGHLVCVNGMESGSKYLCGREIVDFWDRLCNSLGAR
MITVEDLAKKRSVELRLLYGVAYGHSWFGRWGYKFCCGSFGVTKNEYENAIEALGSLEID
QIEFDFGELRQSKEINQVFRYYREMSEGHLKTFRDLLRFMLIIKSHASPQKLLPVTPPLL
TDSPHQKRSSRLLLKKSDVADNDKSPKYRNYSTVAANLGSRWPVRRLIFAAEVIVESLKE
MKALKQNGMTRQDVRDSARLHIGDTGLLDYVLKSMNNVVVGDVLVRRYVDPITRILHYTI
QDLDDAVKAKEPKKKEAVVLEEITPLRILTPLKPGADVYGDLLLLYTNVLLNYPESELVR
SATQAILDSKHFIKEWPIWDNNDTVLQFLCRINPSLVDVRSEQTTELPPGELVTVPLQAT
VYDLKQAIEETFRDTYCILSNFVVTEIDEVEEDMSLIGSCSALTVRGHGIDLESKLKCQG
GCDTWMVKCICRARDDDGERMISCDVCEVWQHTRCCGIDDSDTLPPLFVCSNCCEEFAEQ
QRKVLQPKYEFPSSENVFLLESADDFFGDQRCLGMIFPEENYLL
Download sequence
Identical sequences Q7X6Y7
3702.AT1G66170.1-P NP_176791.2.80155 AT1G66170.1 AT1G66170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]