SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G67180.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G67180.1
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily BRCT domain 4.94e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.016
Further Details:      
 
Domain Number 2 Region: 299-355
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000205
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Weak hits

Sequence:  AT1G67180.1
Domain Number - Region: 400-442
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000101
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G67180.1
Sequence length 453
Sequence
MENVVATVSGYHGSDRFKLIKLISHSGASYVGAMSRSITHLVCWKFEGKKYDLAKKFGTV
VVNHRWVEECVKEGRRVSETPYMFDSGEEVGPLMIELPAVSEEAKVTKKVNKASETFDKY
FSNGGENRSGSTSELATWMEKNVEANRHSVRLRTKRPSSILENKENSGVAESSRKGKKRV
VKQRSYRNLIDLESDEESDNNHHDNSDENQNETQDHREPADENVRGFVFEQGETSALRHP
GDLATPNWDVDEIEESENWSHSAVFKRPRSFSPEIKPQDDDESTREETEATEKAPAQVSC
IICWTEFSSSRGILPCGHRFCYSCIQKWADRLVSERKKTTCPLCKSNFITITKIEDADSS
DQKIYSQTVPDLSSTNNILVVLPEEEEQRQTLNPLTRASGCSRCYLTEPEELLIRCHLCN
FRRIHSYCLDPYLLPWTCNHCNDLQMMYHRRNY
Download sequence
Identical sequences Q9ZW89
3702.AT1G67180.1-P NP_001322040.1.80155 NP_176889.1.80155 AT1G67180.1 AT1G67180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]