SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G69710.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G69710.1
Domain Number 1 Region: 259-648
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.72e-93
Family Regulator of chromosome condensation RCC1 0.001
Further Details:      
 
Domain Number 2 Region: 26-134
Classification Level Classification E-value
Superfamily PH domain-like 9.92e-28
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 3 Region: 647-721
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.69e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  AT1G69710.1
Domain Number - Region: 833-887
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0201
Family Myosin rod fragments 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G69710.1
Sequence length 1041
Sequence
MCILELRLFAAASMADSLRTSFSERDVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDE
SALVWYSGKEEKQIKLSQVLRIVPGQRTPTFKRYPRPEKEYQSFSLICPDRSLDLICKDK
DEAEVWVVGLKSLITRVKVSKWKTTIKPEITSAECPTPHARRVSPFVTILDQVIQPSNET
STQTRLGKVFSDIVAITAPPSNNNQTEASGNLFCPFSPTPANVENSNLRFSTNDPFRLSL
SSAVSTSSHGSYHEDFDALGDVFVWGESISDGVLSGTGNSLNSTTEDALLPKALESTIVL
DAQNIACGKCHAVLVTKQGEIFSWGEGKGGKLGHGLETDAQKPKFISSVRGLGFKSLACG
DFHTCAITQSGDLYSWGDGTHNVDLLGHGNESSCWIPKRVTGDLQGLYVSDVACGPWHTA
VVASSGQLFTFGDGTFGALGHGDRRSTSVPREVESLIGLIVTKVACGVWHTAAVVEVTNE
ASEAEVDSSRGQVFTWGDGEKGQLGHGDNDTKLLPECVISLTNENICQVACGHSLTVSRT
SRGHVYTMGSTAYGQLGNPTAKGNFPERVEGDIVEASVEEIACGSYHVAVLTSKSEIYTW
GKGLNGQLGHGNVENKREPAVVGFLREKQVKAITCGSNFTAVICVHKWVPGSEHSLCAGC
RNPFNFRRKRHNCYNCGLVFCKVCSSRKSLRAALAPDMNKPYRVCYGCFTKLKKSRESSP
STPTSRTRKLLNMRKSTDVSERDSLTQKFLSVNARLSSADSSLHYSERRHHRRDLKPEVN
NSNVFPSMNGSLQPVGSPFSKGSTALPKIPKNMMVKIPGSGMSSRTTSPVSVKSTSPRRS
YEVAAAESKQLKDSFNQDMAGLKEQVEQLASKAHQLEEELEKTKRQLKVVTAMAADEAEE
NRSAKEVIRSLTTQLKEMAEKQSQKDSISTNSKHTDKEKSETVTQTSNQTHIRSMVSQDS
QNENNLTSKSFANGHRKQNDKPEKVVQDEPGVYLTLLSLPGGGTELKRVRFSRKQFTEEQ
AEKWWGENGAKVCERHNILVS
Download sequence
Identical sequences F4I287
AT1G69710.1 NP_177129.2.80155 AT1G69710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]