SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G76950.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G76950.1
Domain Number 1 Region: 237-629
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.89e-93
Family Regulator of chromosome condensation RCC1 0.001
Further Details:      
 
Domain Number 2 Region: 15-123
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-25
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 3 Region: 628-703
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.82e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G76950.1
Sequence length 1103
Sequence
MADLVTYSNADHNLEQALITLKKGTQLLKYGRKGKPKFYPFRLSSDEKSLIWISSSGEKR
LKLASVSKIVPGQRTAVFQRYLRPEKDYLSFSLLYNGKKKSLDLICKDKVEAEIWIGGLK
TLISTGQGGRSKIDGWSGGGLSVDASRELTSSSPSSSSASASRGHSSPGTPFNIDPITSP
KSAEPEVPPTDSEKSHVALDNKNMQTKVSGSDGFRVSVSSAQSSSSHGSAADDSDALGDV
YIWGEVICDNVVKVGIDKNASYLTTRTDVLVPKPLESNIVLDVHQIACGVRHAAFVTRQG
EIFTWGEESGGRLGHGIGKDVFHPRLVESLTATSSVDFVACGEFHTCAVTLAGELYTWGD
GTHNVGLLGHGSDISHWIPKRIAGSLEGLHVASVSCGPWHTALITSYGRLFTFGDGTFGV
LGHGDKETVQYPREVESLSGLRTIAVSCGVWHTAAVVEIIVTQSNSSSVSSGKLFTWGDG
DKNRLGHGDKDPRLKPTCVPALIDYNFHKIACGHSLTVGLTTSGQVFTMGSTVYGQLGNL
QTDGKLPCLVEDKLASEFVEEISCGAYHVAALTSRNEVYTWGKGANGRLGHGDLEDRKVP
TIVEALKDRHVKYIACGSNYTAAICLHKWVSGAEQSQCSTCRLAFGFTRKRHNCYNCGLV
HCHSCSSKKAFRAALAPSAGRLYRVCDSCYVKLSKVSEINDTNRRNSAVPRLSGENRDRL
DKSEIRLAKFGTSNMDLIKQLDSKAAKQGKKTDTFSLGRNSQLPSLLQLKDAVQSNIGDM
RRATPKLAQAPSGISSRSVSPFSRRSSPPRSATPMPSTSGLYFPVGIADNMKKTNEILNQ
EIVKLRTQVDSLTQKCEFQEVELQNSVKKTQEALALAEEESAKSRAAKEAIKSLIAQLKD
VAEKLPPGESVKLACLQNGLDQNGFHFPEENGFHPSRSESMTSSISSVAPFDFAFANASW
SNLQSPKQTPRASERNSNAYPADPRLSSSGSVISERIEPFQFQNNSDNGSSQTGVNNTNQ
VEAEWIEQYEPGVYITLVALHDGTRDLRRVRFSRRRFGEHQAETWWSENREKVYEKYNVR
VSEKSTASQTHRDRDEEEEDIPH
Download sequence
Identical sequences A0A178WMI8 Q947D2
NP_565144.1.80155 AT1G76950.1 3702.AT1G76950.1-P AT1G76950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]