SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G77230.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G77230.1
Domain Number 1 Region: 73-195
Classification Level Classification E-value
Superfamily TPR-like 4.4e-24
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G77230.1
Sequence length 218
Sequence
MKLTWNKNPKKRSRLVLSNFPDLPFEKDDSLESQSHLHFREDDIDRRQTTDQLDSSEVGG
NHPRENFDVEAKKLAESIRAQGDKFAEEGKYQEALGKWEAALNLVPEDAILHEQKAQVLL
ELGDAWKALKAATRATEIDPSWAEAWTTLGRAQLNFGEPDSAIRSFESALLINADSREAK
DDLKSAKQLIKKREQLQTSGQDTDTTRFVVNDKNIEPN
Download sequence
Identical sequences Q8VZL0
NP_177847.2.80155 AT1G77230.1 AT1G77230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]