SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G77250.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G77250.1
Domain Number 1 Region: 405-454
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000399
Family PHD domain 0.0018
Further Details:      
 
Domain Number 2 Region: 229-289
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000204
Family PHD domain 0.0097
Further Details:      
 
Domain Number 3 Region: 343-404
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000642
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G77250.1
Sequence length 522
Sequence
MFMEEATSNGKGTEHNQPNGLVESEALNNWSAGCGAMANSANASSRDSKKIQTYKRRKLG
RSYSANKCSENDRFSMEGVSHSESRESVSYERFSIRTHLTGELPKPPSPNKPSSESTNHE
TVTAGCQHVLSHVLASKEFASLNRLLSENLQGVKIDDFTSRTLIDTRMKEGVYEGSPLLF
STDLQEVWQKMQDVGNDMAVLANSLLELSRTSYKEQLKQFYTGESKPCPNAENIRNDSVS
DICKLCGEKAEARDCLACDHCEDMYHVSCAQPGGKGMPTHSWYCLDCTSKGIGSPHENCV
VCEKMKTQGMMKTDNRSVDTSTECKEDSNESEENSSCNMNHEVHHVEMSRDSELCRTCGT
KVDSGGKYITCDHPFCPHKYYHIRCLTSRQIKLHGVRWYCSSCLCRNCLTDKDDDKIVLC
DGCDDAYHIYCMRPPCESVPNGEWFCTACKAAILKVQKARKAFEKKMETVQKQKGIKPKN
LQGKPQSKDNGELDQSVGGMDMLLNAADTLKDEEQMTFQSIK
Download sequence
Identical sequences Q1JPM3
3702.AT1G77250.1-P AT1G77250.1 NP_177849.2.80155 AT1G77250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]